TkAUNG025440 | RubberDandelionOmics

Gene overview

TkAUNG025440

Reference: TK1151 Chr: ChrUn Coordinates: 6804560-6805728 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

539 bp · TkAUNG025440|TK1151|cDNA

CTGTGCAGGTTGGCTCGATTGAACGGTGCTAAGTTATTTACAACTGCTCGTTTTATCGTATTCCTTCCTAAATTATGTTTCTTGTTTACAAAAAGGGCGGATGAAGAACCTGTTGACCAGAAGAAATACTTTGAAGATTCTTGCAAGCCCAAATGTGTTAGAGCTTGGCTCGAATATCAGGGATGTGTGAAAAGGGTGGAGGCAGATGAAAGTGGGCACAAGCATTGCACAGGGCAGTATTTTGATTATTGGCATTGTGT...

CDS

Download CDS FASTA

303 bp · TkAUNG025440|TK1151|CDS

CTGTGCAGGTTGGCTCGATTGAACGGTGCTAAGTTATTTACAACTGCTCGTTTTATCGTATTCCTTCCTAAATTATGTTTCTTGTTTACAAAAAGGGCGGATGAAGAACCTGTTGACCAGAAGAAATACTTTGAAGATTCTTGCAAGCCCAAATGTGTTAGAGCTTGGCTCGAATATCAGGGATGTGTGAAAAGGGTGGAGGCAGATGAAAGTGGGCACAAGCATTGCACAGGGCAGTATTTTGATTATTGGCATTGTGT...

Protein

Download Protein FASTA

100 aa · TkAUNG025440|TK1151|PROTEIN

LCRLARLNGAKLFTTARFIVFLPKLCFLFTKRADEEPVDQKKYFEDSCKPKCVRAWLEYQGCVKRVEADESGHKHCTGQYFDYWHCVDKCVAPKLFEKLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG025440`
TK1151 ID	TkAUNG025440
OH-1004 ID	LXL04_024566
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.600
Protein coverage (%)	TK1151 41.000 / OH-1004 52.564 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG025440

Location ChrUn:6804560-6805728 (+)

Description Similar to QCR6-1: Cytochrome b-c1 complex subunit 6-1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15120`	Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation.	No verified direct reference in this release
`At2g01090`	Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024566 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0045275 respiratory chain complex III Cellular Component

KEGG gene cross-reference

ath:AT1G15120

ath:AT2G01090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.835

Rank 1 · TkAUNG025440 · TK1151

Cytoplasm0.120

Rank 2 · TkAUNG025440 · TK1151

Nucleus0.079

Rank 3 · TkAUNG025440 · TK1151

Plastid0.053

Rank 4 · TkAUNG025440 · TK1151

Cell membrane0.029

Rank 5 · TkAUNG025440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02320UCR_hinge39-100 aa

PF05254UPF020341-65 aa

PF02297COX6B42-59 aa

PF30733zf-C2H2_CASZ1_164-93 aa

PF02297COX6B69-89 aa

PF05254UPF020373-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG025440	`PF02320`	UCR_hinge	39	100	3.6e-23	82.2
TkAUNG025440	`PF05254`	UPF0203	41	65	0.0052	17.7
TkAUNG025440	`PF02297`	COX6B	42	59	1.4	9.8
TkAUNG025440	`PF30733`	zf-C2H2_CASZ1_1	64	93	0.0049	17.8
TkAUNG025440	`PF02297`	COX6B	69	89	1.4	9.8
TkAUNG025440	`PF05254`	UPF0203	73	99	0.0052	17.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WWE3`	Arabidopsis thaliana	sp\|Q0WWE3\|QCR61_ARATH Cytochrome b-c1 complex subunit 6-1, mitochondrial	76.500%	Swiss-Prot	Medium
`Q9SJV7`	Arabidopsis thaliana	sp\|Q9SJV7\|QCR62_ARATH Cytochrome b-c1 complex subunit 6-2, mitochondrial	78.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card