TkAUNG019550 | RubberDandelionOmics

Gene overview

TkAUNG019550

Reference: TK1151 Chr: ChrUn Coordinates: 5220442-5221792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · TkAUNG019550|TK1151|cDNA

TAGCAAGGTAGATGGTCGTGGCCGCCGTATCCGCATGCCGATCATATGCGCCGCCAGAGTATTCCAGCTTACTCGTGAGCTTGGCCACAAGTCTGATGGTCAGACCATCGAGTGGCTCCTTCGTCAAGCTGAAACCTCAATTATTGCCGCCACCGGTACCGGGACAACTCCTGCTAGCTTCTCTACCGTTTCAGTTGCGGTTCGGAATTCGAATAACTCGTCGCTTTCAGCAGCACTTGACCAGAAATCTTCGGCGCAGC...

CDS

Download CDS FASTA

630 bp · TkAUNG019550|TK1151|CDS

ATGCCGATCATATGCGCCGCCAGAGTATTCCAGCTTACTCGTGAGCTTGGCCACAAGTCTGATGGTCAGACCATCGAGTGGCTCCTTCGTCAAGCTGAAACCTCAATTATTGCCGCCACCGGTACCGGGACAACTCCTGCTAGCTTCTCTACCGTTTCAGTTGCGGTTCGGAATTCGAATAACTCGTCGCTTTCAGCAGCACTTGACCAGAAATCTTCGGCGCAGCATCACCAGCACTTAATCTCTCCGACTCCTTTTAT...

Protein

Download Protein FASTA

209 aa · TkAUNG019550|TK1151|PROTEIN

MPIICAARVFQLTRELGHKSDGQTIEWLLRQAETSIIAATGTGTTPASFSTVSVAVRNSNNSSLSAALDQKSSAQHHQHLISPTPFILGKRLRSDEDGLDGGGKEDNMSSATVVSAAAAGGFWALPARPDFGQVWSFAAAPQEMVVSSPTAIASQQVRFMHNQQPMGEASAARVGNYLPMTQGHLNLLASLSGPPPQSSGFERGFISRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG019550`
TK1151 ID	TkAUNG019550
OH-1004 ID	LXL04_025606
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 80.597 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG019550

Location ChrUn:5220442-5221792 (+)

Description Similar to TCP7: Transcription factor TCP7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23280`	Transcription factor TCP7.	No verified direct reference in this release
`At5g08330`	Transcription factor involved in the regulation of the circadian clock.	No verified direct reference in this release
`At1g58100`	Can specifically bind site II elements in the promoter region of PP438/PNM1.	An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation.2011 · DOI: 10.1105/tpc.110.081638
`At1g72010`	Transcription factor TCP22.	No verified direct reference in this release
`At1g69690`	Transcription factor involved the regulation of plant development.	TCP14 and TCP15 affect internode length and leaf shape in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04674.x The Arabidopsis O-linked N-acetylglucosamine transferase SPINDLY interacts with class I TCPs to facilitate cytokinin responses in leaves and flowers.2012 · DOI: 10.1105/tpc.111.093518 The Arabidopsis immune adaptor SRFR1 interacts with TCP transcription factors that redundantly contribute to effector-triggered immunity.2014 · DOI: 10.1111/tpj.12527 The ubiquitin receptors DA1, DAR1, and DAR2 redundantly regulate endoreduplication by modulating the stability of TCP14/15 in Arabidopsis.2015 · DOI: 10.1105/tpc.114.132274 TCP15 modulates cytokinin and auxin responses during gynoecium development in Arabidopsis.2015 · DOI: 10.1111/tpj.12992 Redox-Dependent Modulation of Anthocyanin Biosynthesis by the TCP Transcription Factor TCP15 during Exposure to High Light Intensity Conditions in Arabidopsis.2016 · DOI: 10.1104/pp.15.01016

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025606 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048511 rhythmic process Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G35560

ath:AT1G58100

ath:AT1G72010

ath:AT5G08330

ath:AT5G23280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · TkAUNG019550 · TK1151

Cytoplasm0.081

Rank 2 · TkAUNG019550 · TK1151

Cell membrane0.020

Rank 3 · TkAUNG019550 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkAUNG019550 · TK1151

Plastid0.010

Rank 5 · TkAUNG019550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634TCP1-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG019550	`PF03634`	TCP	1	78	1.4e-18	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMX2`	Arabidopsis thaliana	sp\|Q9FMX2\|TCP7_ARATH Transcription factor TCP7	58.400%	Swiss-Prot	High
`Q9FTA2`	Arabidopsis thaliana	sp\|Q9FTA2\|TCP21_ARATH Transcription factor TCP21	51.100%	Swiss-Prot	High
`Q9C518`	Arabidopsis thaliana	sp\|Q9C518\|TCP8_ARATH Transcription factor TCP8	75.800%	Swiss-Prot	Low
`Q9C7G4`	Arabidopsis thaliana	sp\|Q9C7G4\|TCP22_ARATH Transcription factor TCP22	53.900%	Swiss-Prot	Low
`Q9C9L2`	Arabidopsis thaliana	sp\|Q9C9L2\|TCP15_ARATH Transcription factor TCP15	62.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card