TkAUNG017350 | RubberDandelionOmics

Gene overview

TkAUNG017350

Reference: TK1151 Chr: ChrUn Coordinates: 4652064-4654846 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1484 bp · TkAUNG017350|TK1151|cDNA

ATGCTTTAGCCCTAAAATAACTCATACACAATGCTTTAGCTCTAAAATGAAATTGACTGCTATGTTGGCTTCAAAATTGGCTCGCCTAAAAGCTTTGACCTCCAAAATTGTCTCCTCCATCGCTCCTTCCAACCCCGACTCAACACCGCGAACACCACTAAGTATCACTCAGACTCCATATACGAGCCCTAGCTGTCTCACCTCGCTCTGCTATCGCCGATCGTTCCTTTGTTGTCGCCGGCAAGCCCTCGATCGCTCTG...

CDS

Download CDS FASTA

405 bp · TkAUNG017350|TK1151|CDS

ATGAGGCACTTGAAATCACTTACAGTTACTGGGATGGTGCGGGCCATAGAAGAGTCATGCAGGTTAGAAAAGGGGATACAATTGAGGAGTTTTTACGGTCTGTTCAGCAACAACTTGCACCTGAGTTTCGTGAAATACGTACAACTTCAGTCCAAATTTATGTCATATGCTGACATAAATGAGGAACTGGAGTTATCTGAGGCATCTTGTGAGGAAGATAATACACGGTCAAATTCCAGTCAATCTGGACAAAAGCAGCC...

Protein

Download Protein FASTA

135 aa · TkAUNG017350|TK1151|PROTEIN

MRHLKSLTVTGMVRAIEESCRLEKGIQLRSFYGLFSNNLHLSFVKYVQLQSKFMSYADINEELELSEASCEEDNTRSNSSQSGQKQPDPPQLSWKLIKTNMFLHPNRKNQTIDEIMVCHCKPSYDGRMECQDECL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG017350`
TK1151 ID	TkAUNG017350
OH-1004 ID	LXL04_003953
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 57.037 / OH-1004 23.054 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG017350

Location ChrUn:4652064-4654846 (-)

Description Similar to XCT: Protein XAP5 CIRCADIAN TIMEKEEPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77300`	Histone methyltransferase involved in di and tri-methylation of 'Lys-36' of histone H3 (H3K36me2 and H3K36me3).	Prevention of early flowering by expression of FLOWERING LOCUS C requires methylation of histone H3 K36.2005 · DOI: 10.1038/ncb1329 Di- and tri- but not monomethylation on histone H3 lysine 36 marks active transcription of genes involved in flowering time regulation and other processes in Arabidopsis thaliana.2008 · DOI: 10.1128/mcb.01607-07 The ASH1 HOMOLOG 2 (ASHH2) histone H3 methyltransferase is required for ovule and anther development in Arabidopsis.2009 · DOI: 10.1371/journal.pone.0007817 Autoimmunity in Arabidopsis acd11 is mediated by epigenetic regulation of an immune receptor.2010 · DOI: 10.1371/journal.ppat.1001137 Histone lysine methyltransferase SDG8 is involved in brassinosteroid-regulated gene expression in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/ssu056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003953 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0009637 response to blue light Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010114 response to red light Biological Process

GO:0035196 miRNA processing Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0048511 rhythmic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0030496 midbody Cellular Component

GO:0045171 intercellular bridge Cellular Component

KEGG gene cross-reference

ath:AT2G21150

dosa:Os09g0535300

dpo:4801527

mmu:108161

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.509

Rank 1 · TkAUNG017350 · TK1151

Cytoplasm0.397

Rank 2 · TkAUNG017350 · TK1151

Mitochondrion0.130

Rank 3 · TkAUNG017350 · TK1151

Cell membrane0.067

Rank 4 · TkAUNG017350 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkAUNG017350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18038FERM_N_22-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG017350	`PF18038`	FERM_N_2	2	64	0.057	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2LAE1`	Arabidopsis thaliana	sp\|Q2LAE1\|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2	47.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card