Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2550 bp · TkAUNG015310|TK1151|cDNA
AATAAAGTCACACCCTCGCCCCAATTTACAACGATACTCGCTTATAAGCCAGACACCAGTCTTCATCCCTTCCATTCGTCCATCTCTGACAGTGAGCAGCTGTGCAGAGACAAAATTCCGTTTCTTCACTCCATTTTTAATTTATCTCTGTAATTGCCATGGCGTCTCCGCTGTGGCTATGCTTCTTAGTAGCAATTCTTTATCCATCATGCTTCACCATTGCAACCGCCAAACAAACGTACATAGTTCAAATGAACAAT...
2280 bp · TkAUNG015310|TK1151|CDS
ATGGCGTCTCCGCTGTGGCTATGCTTCTTAGTAGCAATTCTTTATCCATCATGCTTCACCATTGCAACCGCCAAACAAACGTACATAGTTCAAATGAACAATAATCATAAACCCACATCTTATCTCAATCATCTCGACTGGTACGCCGATAGCCTGCAATCTCTCGCTTCCACTACCTCCGATTCCATTCTATATTCCTACACTAACGCCTACCACGGTTTCTCCGCCTCCTTAGATCCAGACCAAGTGGAGGCTCTCCG...
Protein
Download Protein FASTA759 aa · TkAUNG015310|TK1151|PROTEIN
MASPLWLCFLVAILYPSCFTIATAKQTYIVQMNNNHKPTSYLNHLDWYADSLQSLASTTSDSILYSYTNAYHGFSASLDPDQVEALRQSDSVLGVYEDTVYQLHTTRTPEFLGIENELGLWSGHTPQQLNAASHDVIIGVLDTGVWPESKSFDDSAMPAVPSRWRGECEEGEDFKPTVCNKKLIGARKFSKGFRLAAGAISKEKESPRDQDGHGTHTSTTAAGAQVGNASLFGFASGTARGMSVHARVATYKVCWKTGCF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG015310 |
|---|---|
| TK1151 ID | TkAUNG015310 |
| OH-1004 ID | LXL04_002313 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG015310 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:3950057-3952903 (+) | ||||||||||||||||||
| Description | Similar to SBT1.8: Subtilisin-like protease SBT1.8 | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0009827 plant-type cell wall modification Biological Process GO:0010150 leaf senescence Biological Process GO:0010214 seed coat development Biological Process GO:0010223 secondary shoot formation Biological Process GO:0048731 system development Biological Process GO:0080001 mucilage extrusion from seed coat Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT2G05920 ath:AT3G14067 ath:AT4G34980 ath:AT5G51750 ath:AT5G67360 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17766fn3_621-38 aaPF05922Inhibitor_I927-104 aaPF21864MORF_dom29-102 aaPF00082Peptidase_S8134-582 aaPF21864MORF_dom244-258 aaPF02225PA383-458 aaPF21864MORF_dom616-634 aaPF17766fn3_6659-752 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG015310 | PF17766 | fn3_6 | 21 | 38 | 4.9e-27 | 94.7 |
| TkAUNG015310 | PF05922 | Inhibitor_I9 | 27 | 104 | 5.2e-18 | 66.2 |
| TkAUNG015310 | PF21864 | MORF_dom | 29 | 102 | 0.0019 | 18.7 |
| TkAUNG015310 | PF00082 | Peptidase_S8 | 134 | 582 | 1.7e-43 | 149.7 |
| TkAUNG015310 | PF21864 | MORF_dom | 244 | 258 | 0.0019 | 18.7 |
| TkAUNG015310 | PF02225 | PA | 383 | 458 | 8e-12 | 45.8 |
| TkAUNG015310 | PF21864 | MORF_dom | 616 | 634 | 0.0019 | 18.7 |
| TkAUNG015310 | PF17766 | fn3_6 | 659 | 752 | 4.9e-27 | 94.7 |
| TkAUNG015310 | PF31111 | DUF8812 | 697 | 748 | 0.34 | 11.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9ZUF6 | Arabidopsis thaliana | sp|Q9ZUF6|SBT18_ARATH Subtilisin-like protease SBT1.8 | 67.300% | Swiss-Prot | High |
O65351 | Arabidopsis thaliana | sp|O65351|SBT17_ARATH Subtilisin-like protease SBT1.7 | 55.100% | Swiss-Prot | High |
Q9LVJ1 | Arabidopsis thaliana | sp|Q9LVJ1|SBT14_ARATH Subtilisin-like protease SBT1.4 | 51.400% | Swiss-Prot | High |
Q9FLI4 | Arabidopsis thaliana | sp|Q9FLI4|SBT13_ARATH Subtilisin-like protease SBT1.3 | 51.100% | Swiss-Prot | High |
O49607 | Arabidopsis thaliana | sp|O49607|SBT16_ARATH Subtilisin-like protease SBT1.6 | 49.400% | Swiss-Prot | Medium |