TkAUNG012430 | RubberDandelionOmics

Gene overview

TkAUNG012430

Reference: TK1151 Chr: ChrUn Coordinates: 3077769-3078805 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · TkAUNG012430|TK1151|cDNA

ATGTGCCCTCCTCCTGTCTCCACCAGCTCCTGCCGCTGCCTCCTCAATCATTACCGCTCTCTCGTCTCCTCTTTCTCTCTATCTCTTCTCCAACTCCACTCGCCACCGACCCCAACTATGTCTACGTCCGCAGCTGACGGCGGCGCTGGACCCATTGTCGATCCTTCTCAGAGACTCCACCAGCTTCAGTCCGGTCCCACCAACACCGCCGCCGTCAAGAAGCCTCCCGCTAAGGACCGCCACAGCAAGGTCGACGGCCG...

CDS

Download CDS FASTA

903 bp · TkAUNG012430|TK1151|CDS

ATGTGCCCTCCTCCTGTCTCCACCAGCTCCTGCCGCTGCCTCCTCAATCATTACCGCTCTCTCGTCTCCTCTTTCTCTCTATCTCTTCTCCAACTCCACTCGCCACCGACCCCAACTATGTCTACGTCCGCAGCTGACGGCGGCGCTGGACCCATTGTCGATCCTTCTCAGAGACTCCACCAGCTTCAGTCCGGTCCCACCAACACCGCCGCCGTCAAGAAGCCTCCCGCTAAGGACCGCCACAGCAAGGTCGACGGCCG...

Protein

Download Protein FASTA

300 aa · TkAUNG012430|TK1151|PROTEIN

MCPPPVSTSSCRCLLNHYRSLVSSFSLSLLQLHSPPTPTMSTSAADGGAGPIVDPSQRLHQLQSGPTNTAAVKKPPAKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTVSSSARNSSSSISAALDHKPLAHSLLAPTPFILGKRLRSDDDEHNHHLSKDDVNSVSASVGPTVAAGGFWALPARPDFGQVWSFAAPSHEMQQQQQSHSASLRFLQQQQPLGIGEAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012430`
TK1151 ID	TkAUNG012430
OH-1004 ID	LXL04_025606
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.800
Protein coverage (%)	TK1151 83.333 / OH-1004 93.284 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012430

Location ChrUn:3077769-3078805 (+)

Description Similar to TCP7: Transcription factor TCP7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23280`	Transcription factor TCP7.	No verified direct reference in this release
`At5g08330`	Transcription factor involved in the regulation of the circadian clock.	No verified direct reference in this release
`At1g35560`	Transcription factor TCP23.	No verified direct reference in this release
`At3g47620`	Transcription factor involved the regulation of plant development.	Transcription factor AtTCP14 regulates embryonic growth potential during seed germination in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2007.03308.x TCP14 and TCP15 affect internode length and leaf shape in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04674.x Arabidopsis thaliana DOF6 negatively affects germination in non-after-ripened seeds and interacts with TCP14.2012 · DOI: 10.1093/jxb/err388 The Arabidopsis O-linked N-acetylglucosamine transferase SPINDLY interacts with class I TCPs to facilitate cytokinin responses in leaves and flowers.2012 · DOI: 10.1105/tpc.111.093518 The Arabidopsis immune adaptor SRFR1 interacts with TCP transcription factors that redundantly contribute to effector-triggered immunity.2014 · DOI: 10.1111/tpj.12527 The ubiquitin receptors DA1, DAR1, and DAR2 redundantly regulate endoreduplication by modulating the stability of TCP14/15 in Arabidopsis.2015 · DOI: 10.1105/tpc.114.132274 Pseudomonas syringae Type III Effector HopBB1 Promotes Host Transcriptional Repressor Degradation to Regulate Phytohormone Responses and Virulence.2017 · DOI: 10.1016/j.chom.2017.01.003 ORANGE Represses Chloroplast Biogenesis in Etiolated Arabidopsis Cotyledons via Interaction with TCP14.2019 · DOI: 10.1105/tpc.18.00290
`At1g58100`	Can specifically bind site II elements in the promoter region of PP438/PNM1.	An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation.2011 · DOI: 10.1105/tpc.110.081638

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025606 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048511 rhythmic process Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G35560

ath:AT1G58100

ath:AT1G72010

ath:AT5G08330

ath:AT5G23280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · TkAUNG012430 · TK1151

Cytoplasm0.134

Rank 2 · TkAUNG012430 · TK1151

Cell membrane0.018

Rank 3 · TkAUNG012430 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkAUNG012430 · TK1151

Mitochondrion0.012

Rank 5 · TkAUNG012430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27961CSNKA2IP6-63 aa

PF03634TCP77-190 aa

PF27961CSNKA2IP113-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012430	`PF27961`	CSNKA2IP	6	63	0.1	12.8
TkAUNG012430	`PF03634`	TCP	77	190	1.1e-30	108.0
TkAUNG012430	`PF27961`	CSNKA2IP	113	161	0.1	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMX2`	Arabidopsis thaliana	sp\|Q9FMX2\|TCP7_ARATH Transcription factor TCP7	63.900%	Swiss-Prot	High
`Q9FTA2`	Arabidopsis thaliana	sp\|Q9FTA2\|TCP21_ARATH Transcription factor TCP21	54.500%	Swiss-Prot	High
`Q9LQF0`	Arabidopsis thaliana	sp\|Q9LQF0\|TCP23_ARATH Transcription factor TCP23	59.300%	Swiss-Prot	Low
`Q93Z00`	Arabidopsis thaliana	sp\|Q93Z00\|TCP14_ARATH Transcription factor TCP14	73.600%	Swiss-Prot	Low
`Q9C518`	Arabidopsis thaliana	sp\|Q9C518\|TCP8_ARATH Transcription factor TCP8	80.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card