RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG003650
Reference: TK1151 Chr: ChrUn Coordinates: 1123224-1125943 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1665 bp · TkAUNG003650|TK1151|cDNA

ATTCTCGATGGACCGTAGTCTTTTCTGCTACATATGTCTTGGTCTCCCACCTTGTTTTCTCTCGCCTTTGCCACACCTTTGTTTTTACCCGCCATCCTCGCCATTGCTGCCTCCTTCAACTCTAATTCTAATCTGTTTCATATTGTTTAACGATGTCTGTCCTAAAACAGTTCGAACACCTCAAAATACAACTAGAAGCTATAGAATCAGCAACCAACAAATTTGCTGAAGAGAGTTGCATCGGAAAAGGAGGCTTTGGG...

CDS

Download CDS FASTA

1239 bp · TkAUNG003650|TK1151|CDS

ATGCTTTCAGTTTACAGCCATGAAAATATCGTCTCCCTCTTAGGGTTTTGTGATGAGAAAGACGAGAAGATCCTCGTGTACGAGTATTCATCCCGGGGAAGTCTCGACTTACATCTGGACAACAAGGATCTTACATGGGTTCGACGCCTTACGATTTGTATTGGGGCGGCTCGTGGACTAGCATATCTTCATAATCCTGCAGGTACTCAACAAAGAGTATTGCATAGAGATATTAAAAGTTCCAACATTCTCTTGGATGA...

Protein

Download Protein FASTA

412 aa · TkAUNG003650|TK1151|PROTEIN

MLSVYSHENIVSLLGFCDEKDEKILVYEYSSRGSLDLHLDNKDLTWVRRLTICIGAARGLAYLHNPAGTQQRVLHRDIKSSNILLDENWNARISDLGLSKFGPANQNYTFLITNNRAGTIGYCDPQYVESGILTKESDVYSFGVVLFEVLCGRLCFRSNDKTQCFTQVARKHYKQKSLNEFIWGNIKDQIHPTSLEVFAAIAFQCLKNDSRKRPLMESVVSELETALEYQANMDRFVDQGSLDDNVYGDMDSRDAISQSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG003650
TK1151 IDTkAUNG003650
OH-1004 IDLXL04_015587
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)97.400
Protein coverage (%)TK1151 99.515 / OH-1004 65.102
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG003650
LocationChrUn:1123224-1125943 (+)
DescriptionSimilar to LUG: Transcriptional corepressor LEUNIG
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g32551 Transcription repressor subunit of the SEU-LUG transcriptional corepressor of the C class floral homeotic gene AGAMOUS during the early stages of floral meristem development.
The rotunda2 mutants identify a role for the LEUNIG gene in vegetative leaf morphogenesis.2004 · DOI: 10.1093/jxb/erh165
At5g39000 Putative receptor-like protein kinase At5g39000. No verified direct reference in this release
At5g38990 Probable receptor-like protein kinase At5g38990. No verified direct reference in this release
At2g32700 May act as a transcriptional corepressor-complex subunit that represses abiotic stress-related genes.
The Arabidopsis transcription factor LUH/MUM1 is required for extrusion of seed coat mucilage.2011 · DOI: 10.1104/pp.111.172023
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015587 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0001666 response to hypoxia Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006974 DNA damage response Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009611 response to wounding Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009620 response to fungus Biological Process
GO:0009624 response to nematode Biological Process
GO:0009733 response to auxin Biological Process
GO:0009741 response to brassinosteroid Biological Process
KEGG gene cross-reference
ath:AT2G32700
ath:AT3G46290
ath:AT4G32551
ath:AT5G38990
ath:AT5G39000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.561
Rank 1 · TkAUNG003650 · TK1151
Nucleus0.322
Rank 2 · TkAUNG003650 · TK1151
Cell membrane0.214
Rank 3 · TkAUNG003650 · TK1151
Lysosome / Vacuole0.064
Rank 4 · TkAUNG003650 · TK1151
Golgi apparatus0.058
Rank 5 · TkAUNG003650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr1-223 aa
PF00069Pkinase2-221 aa
PF23389Beta-prop_WDR19_1st13-67 aa
PF23410Beta-prop_VPS851-75 aa
PF08984DUF1858190-210 aa
PF25391WD40_Gbeta250-406 aa
PF23098Beta-prop_NOL10_N250-353 aa
PF24807WD40_CDC20-Fz252-336 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG003650PF07714PK_Tyr_Ser-Thr12231.6e-32113.6
TkAUNG003650PF00069Pkinase22212.2e-34119.8
TkAUNG003650PF23389Beta-prop_WDR19_1st13670.00118.9
TkAUNG003650PF23410Beta-prop_VPS851750.0003420.5
TkAUNG003650PF08984DUF18581902100.09613.5
TkAUNG003650PF25391WD40_Gbeta2504065.2e-1452.7
TkAUNG003650PF23098Beta-prop_NOL10_N2503538e-0625.9
TkAUNG003650PF24807WD40_CDC20-Fz2523365.6e-2175.8
TkAUNG003650PF24805EIF3I2573527.9e-1245.7
TkAUNG003650PF23609Beta-prop_EIPR12583493.9e-1040.4
TkAUNG003650PF25174Beta-prop_THOC32593326.7e-30104.7
TkAUNG003650PF23414Beta-prop_EML_22603993.8e-1969.8
TkAUNG003650PF24105Beta-prop_CAF1B_HIR12603519.8e-1141.9
TkAUNG003650PF23381Beta-prop_IFT122_1st2613522.4e-32113.1
TkAUNG003650PF24782WD40_MABP1-WDR62_2nd2624061.1e-1145.0
TkAUNG003650PF25047Beta-prop_TEP1_2nd2633081.8e-1660.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FUY2Arabidopsis thalianasp|Q9FUY2|LEUNG_ARATH Transcriptional corepressor LEUNIG66.500%Swiss-ProtLow
Q9FID8Arabidopsis thalianasp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g3900045.300%Swiss-ProtMedium
Q9FID9Arabidopsis thalianasp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g3899044.900%Swiss-ProtMedium
O48847Arabidopsis thalianasp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG48.700%Swiss-ProtLow
Q3E8W4Arabidopsis thalianasp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR247.300%Swiss-ProtMedium

JBrowse

View in Genome Browser