TkA08G409780 | RubberDandelionOmics

Gene overview

TkA08G409780

Reference: TK1151 Chr: Chr08 Coordinates: 104287948-104290341 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1828 bp · TkA08G409780|TK1151|cDNA

TCCAGTGCCGAAGCCAAAAGTCGACTTCTAGTCTCACGGGAACATGATGACAAAAAATTGAATAAGAACCGGTAATTCGCTTGCCATCCCTAAATTCTAGGGTTCATCCAAGGATCCCAAAATCAAATCAAACACTTTCTTCTTCTCTCAATCCAGCTAATAATCCAGCAACCTTATGCCATTGAGTTTGATCCGAACAAGTAGCATGGACAGAATCAGCTGCTTGCCTAACGACGTCCTCTGTCACATCCTATCGTTCC...

CDS

Download CDS FASTA

1236 bp · TkA08G409780|TK1151|CDS

ATGCCATTGAGTTTGATCCGAACAAGTAGCATGGACAGAATCAGCTGCTTGCCTAACGACGTCCTCTGTCACATCCTATCGTTCCTCCCAACCAAACACGCCGTTGCGACTTCACTTCTTTCTTCAAGATGGGTAAATTTATGGGCCTTTCTTCCAATCATAGATTTGGACAATTCTCTTTATCTAAACCCATTGAGAAAAGAGTCGAATTCAGTCGTTTTTCTCGACTTCGTTGAAAGGGTTTTGACTGTTAATAGATC...

Protein

Download Protein FASTA

411 aa · TkA08G409780|TK1151|PROTEIN

MPLSLIRTSSMDRISCLPNDVLCHILSFLPTKHAVATSLLSSRWVNLWAFLPIIDLDNSLYLNPLRKESNSVVFLDFVERVLTVNRSQTVRKFRLHVNNSCGQSMSRINGFIHNVISRNVIEIDLGIYLNFPLDDDCLKISNSESLKVLKISSDNGLRMPAFSGCFPNLRVFDVRVSLYESGEDLITKLFPCLSVLEKLSLVGDLTDCTGKLYFNICGAALKSLELELLIDNYDDCDAMVVIDAPQLEYLRLKDGFLASY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G409780`
TK1151 ID	TkA08G409780
OH-1004 ID	LXL04_034247
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 98.297 / OH-1004 92.449 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G409780

Location Chr08:104287948-104290341 (+)

Description Similar to At4g14096: F-box/LRR-repeat protein At4g14096

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22660`	F-box/FBD/LRR-repeat protein At5g22660.	No verified direct reference in this release
`At5g22700`	F-box/FBD/LRR-repeat protein At5g22700.	No verified direct reference in this release
`At3g59190`	F-box/LRR-repeat protein At3g59190.	No verified direct reference in this release
`At4g14096`	F-box/LRR-repeat protein At4g14096.	No verified direct reference in this release
`At4g14103`	F-box/LRR-repeat protein At4g14103.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034247 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G16930

ath:AT3G59190

ath:AT3G59200

ath:AT4G14096

ath:AT5G22660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.839

Rank 1 · TkA08G409780 · TK1151

Cytoplasm0.249

Rank 2 · TkA08G409780 · TK1151

Endoplasmic reticulum0.036

Rank 3 · TkA08G409780 · TK1151

Cell membrane0.034

Rank 4 · TkA08G409780 · TK1151

Plastid0.014

Rank 5 · TkA08G409780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box14-49 aa

PF12937F-box-like14-44 aa

PF12799LRR_4145-174 aa

PF12799LRR_4196-203 aa

PF12799LRR_4196-212 aa

PF12799LRR_4245-252 aa

PF12799LRR_4352-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G409780	`PF00646`	F-box	14	49	1.6e-08	34.9
TkA08G409780	`PF12937`	F-box-like	14	44	4.4e-05	23.9
TkA08G409780	`PF12799`	LRR_4	145	174	0.0013	19.6
TkA08G409780	`PF12799`	LRR_4	196	203	0.0013	19.6
TkA08G409780	`PF12799`	LRR_4	196	212	0.0013	19.6
TkA08G409780	`PF12799`	LRR_4	245	252	0.0013	19.6
TkA08G409780	`PF12799`	LRR_4	352	363	0.0013	19.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNJ5`	Arabidopsis thaliana	sp\|Q9FNJ5\|FDL31_ARATH F-box/FBD/LRR-repeat protein At5g22660	29.700%	Swiss-Prot	Low
`Q9FNJ1`	Arabidopsis thaliana	sp\|Q9FNJ1\|FDL47_ARATH F-box/FBD/LRR-repeat protein At5g22700	28.900%	Swiss-Prot	Low
`Q1PED9`	Arabidopsis thaliana	sp\|Q1PED9\|FBL63_ARATH F-box/LRR-repeat protein At3g59190	30.000%	Swiss-Prot	Medium
`Q94B46`	Arabidopsis thaliana	sp\|Q94B46\|FBL74_ARATH F-box/LRR-repeat protein At4g14096	30.200%	Swiss-Prot	Medium
`Q8L7H1`	Arabidopsis thaliana	sp\|Q8L7H1\|FBL75_ARATH F-box/LRR-repeat protein At4g14103	29.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card