Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2000 bp · TkA08G408260|TK1151|cDNA
ATGTCATTACTCATTACTCAACACCATCGTTTTCTGATCTAGGGCACAAAACTTAACCTCCGGACCGTTGATAGAAATTAGAGCAGTTAGAGCTTTGAATTCGAGCTACAATGTCTTCAAGACACGATAACAGACACGCCGATGGTGATGGAGGTGGAGGTTCATCACCTTATGACGTTTTTGAAGACCGGGATTCACAATTTCAGAAGCATAAAGGGCGTGAAGATAATGAGAGGTCAAAAACCAGAGAAAGAGACCGC...
1233 bp · TkA08G408260|TK1151|CDS
ATGCTTTACTTTCTTTTTCTTCTTCTTCTTCTTCTTCCTATTTTTAATTTTACAGGGCAAGTGACAGATGCTCCTCAAGCAATGCCTGGAATGTTCCAGAACATGTTTCCTTTTGGGACAGCACAGTTGGGAGGTCTTCCCATGATGCCAGCTCAAGCAATGACTCAGCAGGCCACAAGGCATGCACGCCGAGTATATGTTGGCGGTTTGCCCCCATTGGCCAATGAACAGACAATAGCAACTTTTTTCAGCCATATCAT...
Protein
Download Protein FASTA410 aa · TkA08G408260|TK1151|PROTEIN
MLYFLFLLLLLLPIFNFTGQVTDAPQAMPGMFQNMFPFGTAQLGGLPMMPAQAMTQQATRHARRVYVGGLPPLANEQTIATFFSHIMTAIGGNSAGPAGDAVVNVYINHEKKFAFVEMRTVEEASNAMALDGIIFEGVSVRVRRPTDYNPSLAATLGPSQPNPNLNLAAAGLTPGGIGGAEGPDRIFVGGLPYYFTEVQIRELLESFGALRGFDLVKDRDTGNSKGYGFCVYEDQAATDVACAALNGLKMGDKTLTVRRA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G408260 |
|---|---|
| TK1151 ID | TkA08G408260 |
| OH-1004 ID | LXL04_034239 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 95.610 / OH-1004 73.913Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G408260 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:103923535-103928917 (+) | |||||||||
| Description | Similar to U2AF65B: Splicing factor U2af large subunit B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000245 spliceosomal complex assembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0009737 response to abscisic acid Biological Process GO:0000243 commitment complex Cellular Component GO:0005634 nucleus Cellular Component GO:0016607 nuclear speck Cellular Component GO:0071004 U2-type prespliceosome Cellular Component GO:0089701 U2AF complex Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G60900 ath:AT4G36690 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16367RRM_763-84 aaPF00076RRM_165-85 aaPF16842RRM_occluded100-142 aaPF28976RRM_ACIN1102-129 aaPF00076RRM_1107-137 aaPF29326RRM_MUD2_C115-136 aaPF16367RRM_7185-239 aaPF00076RRM_1186-255 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G408260 | PF16367 | RRM_7 | 63 | 84 | 1.1e-05 | 26.0 |
| TkA08G408260 | PF00076 | RRM_1 | 65 | 85 | 3.4e-34 | 117.2 |
| TkA08G408260 | PF16842 | RRM_occluded | 100 | 142 | 0.0018 | 18.8 |
| TkA08G408260 | PF28976 | RRM_ACIN1 | 102 | 129 | 0.01 | 16.6 |
| TkA08G408260 | PF00076 | RRM_1 | 107 | 137 | 3.4e-34 | 117.2 |
| TkA08G408260 | PF29326 | RRM_MUD2_C | 115 | 136 | 9.8e-11 | 42.4 |
| TkA08G408260 | PF16367 | RRM_7 | 185 | 239 | 1.1e-05 | 26.0 |
| TkA08G408260 | PF00076 | RRM_1 | 186 | 255 | 3.4e-34 | 117.2 |
| TkA08G408260 | PF28976 | RRM_ACIN1 | 195 | 249 | 0.01 | 16.6 |
| TkA08G408260 | PF16842 | RRM_occluded | 196 | 219 | 0.0018 | 18.8 |
| TkA08G408260 | PF29326 | RRM_MUD2_C | 229 | 255 | 9.8e-11 | 42.4 |
| TkA08G408260 | PF29326 | RRM_MUD2_C | 308 | 403 | 9.8e-11 | 42.4 |
| TkA08G408260 | PF28977 | DUF8489 | 318 | 349 | 0.00073 | 20.5 |
| TkA08G408260 | PF00076 | RRM_1 | 333 | 393 | 3.4e-34 | 117.2 |
| TkA08G408260 | PF28977 | DUF8489 | 361 | 403 | 0.00073 | 20.5 |
| TkA08G408260 | PF28976 | RRM_ACIN1 | 367 | 388 | 0.01 | 16.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.