TkA08G386820 | RubberDandelionOmics

Gene overview

TkA08G386820

Reference: TK1151 Chr: Chr08 Coordinates: 98732794-98734346 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · TkA08G386820|TK1151|cDNA

ATGGGGCTTAAGAAAGATTCACTATTTTACGAAGATTTAGTAATGACACCTTGTAAAAAGCTAGATGAAGTAAGAAGTAGGGCGATCAGATTCATAAGACTTGAGGAGGACAAGGAAGTCCAAAGAAAGTCAAGCGCTCCAACTTCTTATGATCATCCCAATCGTAAAACTGATTCTTCTTCCTCACAGAGATCCTTCAAGGCAAAACCGTATTCCAAGCCGGATACTCATCTGGTCAATGCTCTTGAAGAGGATACGGA...

CDS

Download CDS FASTA

714 bp · TkA08G386820|TK1151|CDS

ATGGGGCTTAAGAAAGATTCACTATTTTACGAAGATTTAGTAATGACACCTTGTAAAAAGCTAGATGAAGTAAGAAGTAGGGCGATCAGATTCATAAGACTTGAGGAGGACAAGGAAGTCCAAAGAAAGTCAAGCGCTCCAACTTCTTATGATCATCCCAATCGTAAAACTGATTCTTCTTCCTCACAGAGATCCTTCAAGGCAAAACCGTATTCCAAGCCGGATACTCATCTGGTCAATGCTCTTGAAGAGGATACGGA...

Protein

Download Protein FASTA

237 aa · TkA08G386820|TK1151|PROTEIN

MGLKKDSLFYEDLVMTPCKKLDEVRSRAIRFIRLEEDKEVQRKSSAPTSYDHPNRKTDSSSSQRSFKAKPYSKPDTHLVNALEEDTEEEEFPKITDYCFSVDTSGLLYAMQDLGDKARWPRKGEKSNTWKDKSKWCAYHEDFGHITEECIALRKEVSYLLSKGQLKELLGRRNERSRDMSQFQLCLLFTNYLKLSQAGFDRLFGVVISPWSLLCPCMFKCGNGNCLRRNSTQFVAWS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G386820`
TK1151 ID	TkA08G386820
OH-1004 ID	LXL04_019191
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.300
Protein coverage (%)	TK1151 76.371 / OH-1004 10.267 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G386820`
Location	Chr08:98732794-98734346 (-)
Description	Similar to pol: Retrovirus-related Pol polyprotein from transposon opus
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019191` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006313 DNA transposition Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	sce:YIL082W-A These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · TkA08G386820 · TK1151

Nucleus0.385

Rank 2 · TkA08G386820 · TK1151

Mitochondrion0.083

Rank 3 · TkA08G386820 · TK1151

Cell membrane0.073

Rank 4 · TkA08G386820 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA08G386820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14269Arylsulfotran_220-140 aa

PF12217End_beta_propel118-152 aa

PF12217End_beta_propel145-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G386820	`PF14269`	Arylsulfotran_2	20	140	0.25	11.4
TkA08G386820	`PF12217`	End_beta_propel	118	152	0.094	12.4
TkA08G386820	`PF12217`	End_beta_propel	145	200	0.094	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card