TkA08G296340 | RubberDandelionOmics

Gene overview

TkA08G296340

Reference: TK1151 Chr: Chr08 Coordinates: 76812840-76813864 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · TkA08G296340|TK1151|cDNA

ATGTGGGCGACGGCGACGATTCTAATCCCCATTAAAGGGCGACCGGCGAATTACAACGTCATGTTTCAATTAGCGGACTCCGAAGGAACGCCGCTCGGTGCTTCCATATATCTTCCCCAAAGCATTGGCCCCAAGGAGCTTCAACAGATGGTTAACAAGTTGCTCAACAATGAGGAAAGGCTACCATACGCCTTTTATATATCCGATCAAGAGCTTGTTATACAACTAGGAGATTATTTGCAGAAGAACAAAGTTTCTGT...

CDS

Download CDS FASTA

576 bp · TkA08G296340|TK1151|CDS

ATGTGGGCGACGGCGACGATTCTAATCCCCATTAAAGGGCGACCGGCGAATTACAACGTCATGTTTCAATTAGCGGACTCCGAAGGAACGCCGCTCGGTGCTTCCATATATCTTCCCCAAAGCATTGGCCCCAAGGAGCTTCAACAGATGGTTAACAAGTTGCTCAACAATGAGGAAAGGCTACCATACGCCTTTTATATATCCGATCAAGAGCTTGTTATACAACTAGGAGATTATTTGCAGAAGAACAAAGTTTCTGT...

Protein

Download Protein FASTA

191 aa · TkA08G296340|TK1151|PROTEIN

MWATATILIPIKGRPANYNVMFQLADSEGTPLGASIYLPQSIGPKELQQMVNKLLNNEERLPYAFYISDQELVIQLGDYLQKNKVSVEKVVTIVYRPRAVLRIRPVTRCSSTIAGHTEAVLSVVFSLDGQQLASGSGDTTVRLWDLNTQTPLFTCTWHKNWVLCVSWSPDGKHLVSGSKSGEIQICKIRSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G296340`
TK1151 ID	TkA08G296340
OH-1004 ID	LXL04_010891
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.600
Protein coverage (%)	TK1151 73.298 / OH-1004 29.167 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G296340

Location Chr08:76812840-76813864 (+)

Description Similar to NLE1: Notchless protein homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52820`	Required for female gametophyte development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010891 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0007219 Notch signaling pathway Biological Process

GO:0008593 regulation of Notch signaling pathway Biological Process

GO:0009553 embryo sac development Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0045930 negative regulation of mitotic cell cycle Biological Process

GO:0061484 hematopoietic stem cell homeostasis Biological Process

GO:0090263 positive regulation of canonical Wnt signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT5G52820

hsa:54475

mmu:217011

pon:100171489

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.514

Rank 1 · TkA08G296340 · TK1151

Nucleus0.313

Rank 2 · TkA08G296340 · TK1151

Mitochondrion0.099

Rank 3 · TkA08G296340 · TK1151

Cell membrane0.081

Rank 4 · TkA08G296340 · TK1151

Endoplasmic reticulum0.075

Rank 5 · TkA08G296340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22007DUF693014-90 aa

PF08154NLE23-80 aa

PF25047Beta-prop_TEP1_2nd87-188 aa

PF25460Beta-prop_Aladin101-182 aa

PF25174Beta-prop_THOC3107-189 aa

PF25391WD40_Gbeta107-189 aa

PF00400WD40108-145 aa

PF25175Beta-prop_WDR5108-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G296340	`PF22007`	DUF6930	14	90	0.087	13.8
TkA08G296340	`PF08154`	NLE	23	80	1.3e-13	51.9
TkA08G296340	`PF25047`	Beta-prop_TEP1_2nd	87	188	4.8e-14	52.9
TkA08G296340	`PF25460`	Beta-prop_Aladin	101	182	3.5e-06	27.1
TkA08G296340	`PF25174`	Beta-prop_THOC3	107	189	1.4e-19	70.9
TkA08G296340	`PF25391`	WD40_Gbeta	107	189	3e-09	37.1
TkA08G296340	`PF00400`	WD40	108	145	4.4e-20	72.0
TkA08G296340	`PF25175`	Beta-prop_WDR5	108	189	7.9e-18	65.5
TkA08G296340	`PF24807`	WD40_CDC20-Fz	108	183	3.8e-13	50.1
TkA08G296340	`PF24814`	WD40_Prp19	108	188	7.6e-11	42.3
TkA08G296340	`PF24782`	WD40_MABP1-WDR62_2nd	108	146	1.8e-09	37.7
TkA08G296340	`PF23756`	Beta-prop_HPS5	108	189	0.00019	21.5
TkA08G296340	`PF23419`	WD40_RFWD3	108	190	0.055	13.5
TkA08G296340	`PF25173`	Beta-prop_WDR3_1st	109	184	2e-16	61.0
TkA08G296340	`PF23869`	Beta-prop_WDR75_1st	109	146	8.8e-05	22.7
TkA08G296340	`PF24506`	KNTC1_N	109	151	0.06	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLX9`	Arabidopsis thaliana	sp\|Q9FLX9\|NLE1_ARATH Notchless protein homolog	69.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card