TkA08G237430 | RubberDandelionOmics

Gene overview

TkA08G237430

Reference: TK1151 Chr: Chr08 Coordinates: 61851165-61854433 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2751 bp · TkA08G237430|TK1151|cDNA

ATGCAGCGTTTTATGGGGAGTAATGTGGGTGAGTACATTGTTTTCGGTGATTTCAACGCAGTAAGGAAGGCTGGGGAGCGATGGGGCTGCGAGTTTTCCAGCAGAGAAGCTACGGATTTTAATGCGTTTATAATTGATACGGGTCTTACAGAGGTGGATATGGGTGGCTTTGCGTTTACCAGAACTAGCCGTGGAGGAGATAAAATGAGCAAGTTAGACAGGTTTTTGATTACAGATGGAGTGGGGATAGCATATCCGGA...

CDS

Download CDS FASTA

2751 bp · TkA08G237430|TK1151|CDS

ATGCAGCGTTTTATGGGGAGTAATGTGGGTGAGTACATTGTTTTCGGTGATTTCAACGCAGTAAGGAAGGCTGGGGAGCGATGGGGCTGCGAGTTTTCCAGCAGAGAAGCTACGGATTTTAATGCGTTTATAATTGATACGGGTCTTACAGAGGTGGATATGGGTGGCTTTGCGTTTACCAGAACTAGCCGTGGAGGAGATAAAATGAGCAAGTTAGACAGGTTTTTGATTACAGATGGAGTGGGGATAGCATATCCGGA...

Protein

Download Protein FASTA

916 aa · TkA08G237430|TK1151|PROTEIN

MQRFMGSNVGEYIVFGDFNAVRKAGERWGCEFSSREATDFNAFIIDTGLTEVDMGGFAFTRTSRGGDKMSKLDRFLITDGVGIAYPELSAMALDCVISDHRPICLKEDVKDYGPKHFRFLNSWLQEESFEQVVRNSWEKVEESGRRGAAIRLKNKLKTLKEDIKAWWKKTNEGREKEKKQIDANLKEIEKKIDLGVASQEELEARLKLREMVFKMEKKMRQMAIKGVKKEGEWVVDPVLVKNVFIEHYKEKFKASPNLRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G237430`
TK1151 ID	TkA08G237430
OH-1004 ID	LXL04_006431
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.700
Protein coverage (%)	TK1151 98.035 / OH-1004 47.337 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G237430`
Location	Chr08:61851165-61854433 (+)
Description	Similar to LINE-1 reverse transcriptase homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006431` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003824 catalytic activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619

Rank 1 · TkA08G237430 · TK1151

Nucleus0.306

Rank 2 · TkA08G237430 · TK1151

Cell membrane0.118

Rank 3 · TkA08G237430 · TK1151

Golgi apparatus0.039

Rank 4 · TkA08G237430 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA08G237430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14529Exo_endo_phos_211-104 aa

PF03372Exo_endo_phos12-100 aa

PF07195FliD_C125-222 aa

PF09304Cortex-I_coil147-208 aa

PF16454PI3K_P85_iSH2156-220 aa

PF00078RVT_1355-407 aa

PF00078RVT_1428-511 aa

PF16454PI3K_P85_iSH2533-553 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G237430	`PF14529`	Exo_endo_phos_2	11	104	0.00036	21.1
TkA08G237430	`PF03372`	Exo_endo_phos	12	100	0.09	13.2
TkA08G237430	`PF07195`	FliD_C	125	222	0.8	9.8
TkA08G237430	`PF09304`	Cortex-I_coil	147	208	0.64	11.0
TkA08G237430	`PF16454`	PI3K_P85_iSH2	156	220	0.96	9.7
TkA08G237430	`PF00078`	RVT_1	355	407	2.1e-10	41.5
TkA08G237430	`PF00078`	RVT_1	428	511	2.1e-10	41.5
TkA08G237430	`PF16454`	PI3K_P85_iSH2	533	553	0.96	9.7
TkA08G237430	`PF13966`	zf-RVT	746	815	5.2e-14	53.4
TkA08G237430	`PF13966`	zf-RVT	857	870	5.2e-14	53.4
TkA08G237430	`PF13966`	zf-RVT	889	897	5.2e-14	53.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card