Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2025 bp · TkA08G212100|TK1151|cDNA
CTCAATCAAATTAAAACATACCTGCCTCACTTGTTACTACACTCCAGCGACAAATCCGCTGCTCAAAATCCAATCCGATTTCACTATTTCAAGACTAACACATCTCAATTTTCTCGATTCTTTTCATTTAAGGATCTGATTTCGTTTTTCAAGTTTTCGATCTTTTACGTAAAAAAACGACAGTCCAAGGTTCGTTGTCATTCAAAATAGTCAAGGATTTGATGAAAGATAAAAGCTAAAGTAGCTGCAAAGAGATCATT...
1608 bp · TkA08G212100|TK1151|CDS
ATGGGAAGAAGTTTGAGCCCAGTGCTACGCCGCGAGCTGGAAAATCTCGATAAAGACGCCGCCAGTAGAAAATCCGCCATGAAAGCGTTAAAATCATACGTAAAAGATCTAGATTCAAAAGCAATCCCAATTTTTCTCGCTCAAGTCTCAGAAACCAAAGAAACCGGATCCACATCCGGCGAATACACAATCTCACTCTACGAAGTCCTTGCTCGCGTTCACGGTACCAAAATCGTCCCACAAATCCACAACATCATGTC...
Protein
Download Protein FASTA535 aa · TkA08G212100|TK1151|PROTEIN
MGRSLSPVLRRELENLDKDAASRKSAMKALKSYVKDLDSKAIPIFLAQVSETKETGSTSGEYTISLYEVLARVHGTKIVPQIHNIMSTIIKTLTSTASSFALHQACAKVVPAIARYGIDPTTDDNKKREIIRSLFKPLSDSLLSSHENLSSGSALCLKALVDSDNWRFSSSEMVNEVCQRVAGALEKGKTVNSHMGLVMALAKHNGLIVEAYARLLIRSGIGILKMGVEENNSQYRLSAIQMVNFLIRSLDYKCVMSELP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G212100 |
|---|---|
| TK1151 ID | TkA08G212100 |
| OH-1004 ID | LXL04_014374 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 60.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G212100 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:55508474-55510788 (+) | |||||||||
| Description | Similar to SINE1: Protein SINE1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000387 spliceosomal snRNP assembly Biological Process GO:0007097 nuclear migration Biological Process GO:0061760 antifungal innate immune response Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005874 microtubule Cellular Component GO:0031965 nuclear membrane Cellular Component GO:0032797 SMN complex Cellular Component GO:0003779 actin binding Molecular Function GO:0008017 microtubule binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G54385 ath:AT3G03970 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23271HEAT_GCN117-49 aaPF24987HEAT_EF3_N17-96 aaPF24714TOR1L1_N19-287 aaPF04003Utp1227-96 aaPF03224V-ATPase_H_N39-95 aaPF23271HEAT_GCN169-118 aaPF11865mTOR_dom74-98 aaPF14914LRRC37AB_C81-110 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G212100 | PF23271 | HEAT_GCN1 | 17 | 49 | 0.016 | 16.1 |
| TkA08G212100 | PF24987 | HEAT_EF3_N | 17 | 96 | 0.1 | 13.3 |
| TkA08G212100 | PF24714 | TOR1L1_N | 19 | 287 | 4.4e-20 | 72.9 |
| TkA08G212100 | PF04003 | Utp12 | 27 | 96 | 0.14 | 13.0 |
| TkA08G212100 | PF03224 | V-ATPase_H_N | 39 | 95 | 0.38 | 10.9 |
| TkA08G212100 | PF23271 | HEAT_GCN1 | 69 | 118 | 0.016 | 16.1 |
| TkA08G212100 | PF11865 | mTOR_dom | 74 | 98 | 0.023 | 15.4 |
| TkA08G212100 | PF14914 | LRRC37AB_C | 81 | 110 | 0.032 | 14.9 |
| TkA08G212100 | PF03224 | V-ATPase_H_N | 87 | 182 | 0.38 | 10.9 |
| TkA08G212100 | PF11865 | mTOR_dom | 117 | 147 | 0.023 | 15.4 |
| TkA08G212100 | PF23271 | HEAT_GCN1 | 168 | 261 | 0.016 | 16.1 |
| TkA08G212100 | PF24987 | HEAT_EF3_N | 174 | 271 | 0.1 | 13.3 |
| TkA08G212100 | PF11865 | mTOR_dom | 208 | 268 | 0.023 | 15.4 |
| TkA08G212100 | PF03224 | V-ATPase_H_N | 221 | 256 | 0.38 | 10.9 |
| TkA08G212100 | PF23271 | HEAT_GCN1 | 223 | 286 | 0.016 | 16.1 |
| TkA08G212100 | PF24714 | TOR1L1_N | 230 | 306 | 4.4e-20 | 72.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.