TkA08G199850 | RubberDandelionOmics

Gene overview

TkA08G199850

Reference: TK1151 Chr: Chr08 Coordinates: 52171255-52172178 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

783 bp · TkA08G199850|TK1151|cDNA

AGTTCTGTTCTGAGCCTTGGAATAACTGGTACGCAAACAGAATAAAAGTCTTTCTCCCTTTCTGATCCGAAAAGAACGCCCTAATTCGTAACCATGAACCCTAACAAATCCCCTTCTGTTGCATCATCGCTGATCATCACTGCCTTCTTGCTGTTCTCCACTTTCGATTTCGGGGTTTGCGAAGCTGAAAAAGGTATGATAAGGTCCCAAAAGATAGGCGGAATTCGTGATATAGCGGATAATGGGATCGAGATAGAAAC...

CDS

Download CDS FASTA

402 bp · TkA08G199850|TK1151|CDS

ATGAACCCTAACAAATCCCCTTCTGTTGCATCATCGCTGATCATCACTGCCTTCTTGCTGTTCTCCACTTTCGATTTCGGGGTTTGCGAAGCTGAAAAAGGTATGATAAGGTCCCAAAAGATAGGCGGAATTCGTGATATAGCGGATAATGGGATCGAGATAGAAACCCTCGCTCGATTCGCTGTCGAACAACACAACACAAAAGAGAACTCCCTTCTCAAATTCTCTAGATTGATAAAGGCTAAAGAGCAGGTGGTTGC...

Protein

Download Protein FASTA

133 aa · TkA08G199850|TK1151|PROTEIN

MNPNKSPSVASSLIITAFLLFSTFDFGVCEAEKGMIRSQKIGGIRDIADNGIEIETLARFAVEQHNTKENSLLKFSRLIKAKEQVVAGMMYYLTLEATNADGKIKVYETKVWVKPWMNVKEVQEFKASDNQSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G199850`
TK1151 ID	TkA08G199850
OH-1004 ID	LXL04_032708
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G199850

Location Chr08:52171255-52172178 (+)

Description Similar to CYS3: Cysteine proteinase inhibitor 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40880`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release
`At3g12490`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release
`At5g05110`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032708 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004869 cysteine-type endopeptidase inhibitor activity Molecular Function

GO:0050897 cobalt ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G40880

ath:AT3G12490

ath:AT5G05110

dosa:Os01g0270100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.466

Rank 1 · TkA08G199850 · TK1151

Endoplasmic reticulum0.215

Rank 2 · TkA08G199850 · TK1151

Cytoplasm0.154

Rank 3 · TkA08G199850 · TK1151

Lysosome / Vacuole0.153

Rank 4 · TkA08G199850 · TK1151

Cell membrane0.093

Rank 5 · TkA08G199850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00031Cystatin42-127 aa

PF16845SQAPI44-127 aa

PF07430PP155-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G199850	`PF00031`	Cystatin	42	127	9.1e-20	71.4
TkA08G199850	`PF16845`	SQAPI	44	127	1.1e-19	71.3
TkA08G199850	`PF07430`	PP1	55	115	0.036	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q41906`	Arabidopsis thaliana	sp\|Q41906\|CYT3_ARATH Cysteine proteinase inhibitor 3	47.900%	Swiss-Prot	Medium
`Q8H0X6`	Arabidopsis thaliana	sp\|Q8H0X6\|CYT6_ARATH Cysteine proteinase inhibitor 6	54.500%	Swiss-Prot	High
`Q8LC76`	Arabidopsis thaliana	sp\|Q8LC76\|CYT7_ARATH Cysteine proteinase inhibitor 7	47.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card