TkA08G184770 | RubberDandelionOmics

Gene overview

TkA08G184770

Reference: TK1151 Chr: Chr08 Coordinates: 48256289-48257247 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

856 bp · TkA08G184770|TK1151|cDNA

TTGTTTTAATACTTAATTTTAATTAAAAATTAAACGAGACCCATTAATTACACCCACTCATCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCCCCACCGTCTCTCCTCTCTCTCAATCGATCCGTTTCAGGAACGACCTCCCCCATACATCGATGATCGATCTCTTTCAGGTGAAAACCAAAAGAGCATACCTCAAAATCACGAGATTTTTGCACGAAATAAAAAATGAAAGCAGACCCAGATGGGAAATCGACGAGATC...

CDS

Download CDS FASTA

342 bp · TkA08G184770|TK1151|CDS

ATGGACTCATCATCAAACAACTACACCAATAAGGCGAGAACAACACTCTTCACGATAATGGCATTTGCTGTTTTTATCGTCGCTCTGTTGCTCCTCCCCTTCAGCTGCTACTGCTACTTGCGCAACAAAGTTTCCAATTTCTCGAAGAACCCAAAAGATGGGATTGACTCTGTCAAAAAGGGGAATGGTGAGTCAAAAACTCAACTTCTTGTCGTAAAAGGACTTCAAGTCTTCACGTTTAAGCAAGGCGAAGATAGCGA...

Protein

Download Protein FASTA

113 aa · TkA08G184770|TK1151|PROTEIN

MDSSSNNYTNKARTTLFTIMAFAVFIVALLLLPFSCYCYLRNKVSNFSKNPKDGIDSVKKGNGESKTQLLVVKGLQVFTFKQGEDSEDGRKIAVKLIDQAGKQGKEESGFFQI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G184770`
TK1151 ID	TkA08G184770
OH-1004 ID	LXL04_026183
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.100
Protein coverage (%)	TK1151 94.690 / OH-1004 38.425 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G184770`
Location	Chr08:48256289-48257247 (-)
Description	Similar to PBS1: Serine/threonine-protein kinase PBS1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026183` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002221 pattern recognition receptor signaling pathway Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006952 defense response Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010483 pollen tube reception Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045087 innate immune response Biological Process GO:0046777 protein autophosphorylation Biological Process GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G20650 ath:AT3G07070 ath:AT3G20530 ath:AT5G02800 ath:AT5G13160 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.324

Rank 1 · TkA08G184770 · TK1151

Cell membrane0.255

Rank 2 · TkA08G184770 · TK1151

Nucleus0.177

Rank 3 · TkA08G184770 · TK1151

Cytoplasm0.146

Rank 4 · TkA08G184770 · TK1151

Golgi apparatus0.100

Rank 5 · TkA08G184770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05078DUF6798-42 aa

PF09225Endonuc-PvuII52-101 aa

PF05078DUF67956-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G184770	`PF05078`	DUF679	8	42	0.14	12.8
TkA08G184770	`PF09225`	Endonuc-PvuII	52	101	0.3	11.6
TkA08G184770	`PF05078`	DUF679	56	98	0.14	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card