TkA08G178370 | RubberDandelionOmics

Gene overview

TkA08G178370

Reference: TK1151 Chr: Chr08 Coordinates: 46679336-46681126 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

705 bp · TkA08G178370|TK1151|cDNA

ATAACCCTTGAATGCATAACTCCTAAACGTGACTCCGTCACTGGAGGGAAGACCGTGGTGACGAACGATACTACAGCAACGACTCCAGAATTAGGGTTTTGGAATGGCGATTGGTGGAAATTCGTTTGAAGTCAATCCCGAGACAGAGAAGTTTCTTTGTGAGCGATTGTTGGATCAAACGCAGCCAATTTCGGAGCGATTCAGAGTCCTCTTTTCTCACCGTCACTACACCATCGTCTCCACTAAATTACATACTGTTC...

CDS

Download CDS FASTA

354 bp · TkA08G178370|TK1151|CDS

ATGGTCGTATTAAAGACAAAGGAAGAAGGATTAAATGCCATGAGTTTATGTATTATGAAATGTGCATGCATATCTTCTCGGAAGGGAGCCTGGCCACCCTCGGTTAACATTTCAGAAGGATGTTGTGAAGCTATGAAATACTATTCAGATGACTGGCCAACTAATAGTTCTAAAGAAGCATTTGAAAAGTCTGTGTTTACCAAGACTCAGAAGACAAATGCACGAACAAAATTTCTTTGGGGTTTCTTTGATGCAGTTGG...

Protein

Download Protein FASTA

117 aa · TkA08G178370|TK1151|PROTEIN

MVVLKTKEEGLNAMSLCIMKCACISSRKGAWPPSVNISEGCCEAMKYYSDDWPTNSSKEAFEKSVFTKTQKTNARTKFLWGFFDAVGLLPRGNVDKKEALENLDLSLLCLDEIVDGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G178370`
TK1151 ID	TkA08G178370
OH-1004 ID	LXL04_027643
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.800
Protein coverage (%)	TK1151 68.376 / OH-1004 70.303 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G178370

Location Chr08:46679336-46681126 (+)

Description Similar to COPZ2: Coatomer subunit zeta-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60970`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`At3g09800`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`At4g08520`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0317400`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`Os01g0838800`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027643 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030126 COPI vesicle coat Cellular Component

KEGG gene cross-reference

ath:AT1G60970

ath:AT3G09800

ath:AT4G08520

dosa:Os02g0317400

dosa:Os05g0461000

osa:4329152

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.363

Rank 1 · TkA08G178370 · TK1151

Nucleus0.278

Rank 2 · TkA08G178370 · TK1151

Mitochondrion0.240

Rank 3 · TkA08G178370 · TK1151

Extracellular0.123

Rank 4 · TkA08G178370 · TK1151

Cell membrane0.093

Rank 5 · TkA08G178370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940S5`	Arabidopsis thaliana	sp\|Q940S5\|COPZ1_ARATH Coatomer subunit zeta-1	52.800%	Swiss-Prot	High
`Q84LG4`	Arabidopsis thaliana	sp\|Q84LG4\|COPZ2_ARATH Coatomer subunit zeta-2	50.900%	Swiss-Prot	Medium
`Q8H1F4`	Arabidopsis thaliana	sp\|Q8H1F4\|COPZ3_ARATH Coatomer subunit zeta-3	51.700%	Swiss-Prot	Medium
`Q6Z844`	Oryza sativa subsp. japonica	sp\|Q6Z844\|COPZ2_ORYSJ Coatomer subunit zeta-2	50.900%	Swiss-Prot	Medium
`Q5NA06`	Oryza sativa subsp. japonica	sp\|Q5NA06\|COPZ3_ORYSJ Coatomer subunit zeta-3	66.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card