TkA08G160380 | RubberDandelionOmics

Gene overview

TkA08G160380

Reference: TK1151 Chr: Chr08 Coordinates: 41836179-41838129 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1277 bp · TkA08G160380|TK1151|cDNA

AATTACACTACGTTTTAAGTCATCGAAGATTGATCTATCACGTGAAATCGTTCCCGCTGATTTTAATTAAACTGCGCGATTCTTTCGAAAATGATATTGTAGCGCTTTTCAATCATCCATCATTCATTATCTCTTTCCCATTTTCCTCATGTTTCTCTCCATATTTTCTCTATGGCTGCAACCTCTCTTTTTCTTTCGGAAAATCATCTCACTACAATCGGTCTACGGCGTCATTAACCGTTTTCCGATATCCTTCGCCG...

CDS

Download CDS FASTA

975 bp · TkA08G160380|TK1151|CDS

ATGTTTCTCTCCATATTTTCTCTATGGCTGCAACCTCTCTTTTTCTTTCGGAAAATCATCTCACTACAATCGGTCTACGGCGTCATTAACCGTTTTCCGATATCCTTCGCCGATGGGATGCTATCGGTTTACTTACGCTACTGTGGCCTGTCCCAATCTACGATCCACCTCGACGACAACCAAACCACAATGTATATTCGGGCACCCAGCCACAGGAGCAAGAGTAAACCGAACCTCGTGCTCGTCCATGGATTTGGCGT...

Protein

Download Protein FASTA

324 aa · TkA08G160380|TK1151|PROTEIN

MFLSIFSLWLQPLFFFRKIISLQSVYGVINRFPISFADGMLSVYLRYCGLSQSTIHLDDNQTTMYIRAPSHRSKSKPNLVLVHGFGVNSKWQFLLQVNQLMRDFNVYIPDLVFFGDSYSSMSDRSVKFQAKCVCDGLKKIGVEKFSVYAISYGGFVGYRMAETYEDMVEKLVIVSSGIVYSDDQKLEHMKYIGRSVVDLLVPKTPEDFRMLCRLTIQKVDIGKWIPEFFLWGLISFECCKKEKEELVLELLNEKPDVHYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G160380`
TK1151 ID	TkA08G160380
OH-1004 ID	LXL04_015649
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.000
Protein coverage (%)	TK1151 84.259 / OH-1004 92.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G160380`
Location	Chr08:41836179-41838129 (+)
Description	Similar to lip3: Lipase 3 (Moraxella sp. (strain TA144)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015649` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009395 phospholipid catabolic process Biological Process GO:0046464 acylglycerol catabolic process Biological Process GO:0046889 positive regulation of lipid biosynthetic process Biological Process GO:0052651 monoacylglycerol catabolic process Biological Process GO:0120163 negative regulation of cold-induced thermogenesis Biological Process GO:2001311 lysobisphosphatidic acid metabolic process Biological Process GO:0005765 lysosomal membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031902 late endosome membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0004620 glycerophospholipase activity Molecular Function
KEGG gene cross-reference	bta:505283 xla:380544 xla:444738 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.573

Rank 1 · TkA08G160380 · TK1151

Lysosome / Vacuole0.163

Rank 2 · TkA08G160380 · TK1151

Cytoplasm0.155

Rank 3 · TkA08G160380 · TK1151

Golgi apparatus0.110

Rank 4 · TkA08G160380 · TK1151

Nucleus0.097

Rank 5 · TkA08G160380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_475-212 aa

PF00561Abhydrolase_177-203 aa

PF12697Abhydrolase_679-310 aa

PF00561Abhydrolase_1260-310 aa

PF12146Hydrolase_4262-308 aa

PF08386Abhydrolase_4263-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G160380	`PF12146`	Hydrolase_4	75	212	2.9e-07	30.8
TkA08G160380	`PF00561`	Abhydrolase_1	77	203	1.2e-14	55.3
TkA08G160380	`PF12697`	Abhydrolase_6	79	310	4.4e-08	34.7
TkA08G160380	`PF00561`	Abhydrolase_1	260	310	1.2e-14	55.3
TkA08G160380	`PF12146`	Hydrolase_4	262	308	2.9e-07	30.8
TkA08G160380	`PF08386`	Abhydrolase_4	263	320	0.0092	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card