TkA08G151410 | RubberDandelionOmics

Gene overview

TkA08G151410

Reference: TK1151 Chr: Chr08 Coordinates: 39436516-39456660 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2089 bp · TkA08G151410|TK1151|cDNA

AATAGACATATAAAATGGGTTTAAACACGAACCGAGTGGAGGACAATTCGGGTTCGGGTCATGCTCAAACAGAAACCACCACGGTTTCTATAGTAGTTCCGCCGGAAACAATGGAGCCACGGGAACTACACGGCGTCTGTCTCCCGCCGAAGAAAACTAGTTTTCAGAAACTCCGGCACAAACTGTCGGAGATTTTCTTCCCTGATGATCCTCTCCACAGATTTAAAAACCAAACACGCTTTAACAAATTCCTCTTCGCT...

CDS

Download CDS FASTA

1830 bp · TkA08G151410|TK1151|CDS

ATGGGTTTAAACACGAACCGAGTGGAGGACAATTCGGGTTCGGGTCATGCTCAAACAGAAACCACCACGGTTTCTATAGTAGTTCCGCCGGAAACAATGGAGCCACGGGAACTACACGGCGTCTGTCTCCCGCCGAAGAAAACTAGTTTTCAGAAACTCCGGCACAAACTGTCGGAGATTTTCTTCCCTGATGATCCTCTCCACAGATTTAAAAACCAAACACGCTTTAACAAATTCCTCTTCGCTCTTCATTACGTCTT...

Protein

Download Protein FASTA

609 aa · TkA08G151410|TK1151|PROTEIN

MGLNTNRVEDNSGSGHAQTETTTVSIVVPPETMEPRELHGVCLPPKKTSFQKLRHKLSEIFFPDDPLHRFKNQTRFNKFLFALHYVFPIFQWAPTYNLTLFRSDVVAGLTIASLAIPQGISYAKLANLPPVIGLYSSFVPPLIYAVLGSSKHLAVGPVSIASLVMGTMLNDAVSYSLNPVLYLKLAFTATFFAGLFQASLGFLRLGFLIDFLSKATLVGFMAGAAVIVSMQQLKGLLGIVNFTTKMQIIPVLSSVIEQRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G151410`
TK1151 ID	TkA08G151410
OH-1004 ID	LXL04_032120
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 99.836 / OH-1004 91.704 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G151410

Location Chr08:39436516-39456660 (+)

Description Similar to SULTR3;4: Probable sulfate transporter 3.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15990`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At1g23090`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At3g51895`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At1g22150`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate loading into sieve tubes.	Phloem-localizing sulfate transporter, Sultr1;3, mediates re-distribution of sulfur from source to sink organs in Arabidopsis.2003 · DOI: 10.1104/pp.014712
`At1g78000`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate uptake by plant roots.	Two distinct high-affinity sulfate transporters with different inducibilities mediate uptake of sulfate in Arabidopsis roots.2002 · DOI: 10.1046/j.0960-7412.2001.01231.x Selenate-resistant mutants of Arabidopsis thaliana identify Sultr1;2, a sulfate transporter required for efficient transport of sulfate into roots.2002 · DOI: 10.1046/j.0960-7412.2001.01232.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032120 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006817 phosphate ion transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G23090

ath:AT3G15990

ath:AT3G51895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.597

Rank 1 · TkA08G151410 · TK1151

Lysosome / Vacuole0.153

Rank 2 · TkA08G151410 · TK1151

Cytoplasm0.138

Rank 3 · TkA08G151410 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA08G151410 · TK1151

Mitochondrion0.062

Rank 5 · TkA08G151410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916Sulfate_transp101-480 aa

PF14360PAP2_C103-114 aa

PF14360PAP2_C419-457 aa

PF01740STAS534-606 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G151410	`PF00916`	Sulfate_transp	101	480	1.8e-127	426.0
TkA08G151410	`PF14360`	PAP2_C	103	114	0.26	12.6
TkA08G151410	`PF14360`	PAP2_C	419	457	0.26	12.6
TkA08G151410	`PF01740`	STAS	534	606	1.2e-14	54.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW86`	Arabidopsis thaliana	sp\|Q9LW86\|SUT34_ARATH Probable sulfate transporter 3.4	70.100%	Swiss-Prot	High
`Q9SXS2`	Arabidopsis thaliana	sp\|Q9SXS2\|SUT33_ARATH Probable sulfate transporter 3.3	64.200%	Swiss-Prot	High
`Q9SV13`	Arabidopsis thaliana	sp\|Q9SV13\|SUT31_ARATH Sulfate transporter 3.1	56.000%	Swiss-Prot	High
`Q9FEP7`	Arabidopsis thaliana	sp\|Q9FEP7\|SUT13_ARATH Sulfate transporter 1.3	54.100%	Swiss-Prot	High
`Q9MAX3`	Arabidopsis thaliana	sp\|Q9MAX3\|SUT12_ARATH Sulfate transporter 1.2	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card