TkA08G151100 | RubberDandelionOmics

Gene overview

TkA08G151100

Reference: TK1151 Chr: Chr08 Coordinates: 39354104-39361411 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2196 bp · TkA08G151100|TK1151|cDNA

TGCTCTCTATTTTTTTCCCACCTATATACGTTACTCATCCTATACACATCTCTTCTCCCTGCAAGCCTTCTGAGATTTGGTCCCTTTCCATCACTCATACTATCCATACGAAGCACAATCTCGTTTTTGTTGAGTATCTCGCGGATTGTAGTTGTTTCTCAACCTGTTGAGAAGTAGGTTTTTCTACTGGTACGTTAGGGTTTATCTTTTGGTTACTGAGAACTGATACGATGGACGTTGGGGACGAAGAGTATGAGAGT...

CDS

Download CDS FASTA

1629 bp · TkA08G151100|TK1151|CDS

ATGGACGTTGGGGACGAAGAGTATGAGAGTGATCCGGAGCAGGCGAAGCTTTCTTTGAAGATGCGACGGAGGGAGGCGAGTGACGATGAGGAGGAAGAGGATCGTGACAGAGGTAGGGAGATGAGAACTAATTCTAGGGTTTCCGATTGTGAGTCTGACGGACAGGGTGCGGCTGCTGATTACGATGAAGAGAAATCGGATTTGGAGGATGAGCTTCCTGAGAAAGTTGGAGAAGGAGAAGAACAGTTCGGAGAACACCA...

Protein

Download Protein FASTA

542 aa · TkA08G151100|TK1151|PROTEIN

MDVGDEEYESDPEQAKLSLKMRRREASDDEEEEDRDRGREMRTNSRVSDCESDGQGAAADYDEEKSDLEDELPEKVGEGEEQFGEHHGGSDTQGLEAKVLRKDLVDVQDNVDQFDANVNENVEEQGEEEKKENDPFSVPTAGAFYMHDDRFRDSVSGKHRRTPDSRKLWETRDDKRWGHDKFEEMSMQERNYKEGRRMSRGRNHNHNQARDRNKGENHEYSQRNTPKAPRGRGPKMYQSASKSNTERGPLKSLDKASHAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G151100`
TK1151 ID	TkA08G151100
OH-1004 ID	LXL04_032115
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G151100

Location Chr08:39354104-39361411 (-)

Description Similar to MLN51: Protein MLN51 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15970`	Probably involved in nucleocytoplasmic transport via its interactions with importins and Ran, rather than by forming part of the nuclear pore complex (NPC) scaffolding.	No verified direct reference in this release
`At1g52380`	Probably involved in nucleocytoplasmic transport via its interactions with importins and Ran, rather than by forming part of the nuclear pore complex (NPC) scaffolding.	No verified direct reference in this release
`At1g80000`	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032115 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006417 regulation of translation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0051028 mRNA transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0035145 exon-exon junction complex Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G80000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.594

Rank 1 · TkA08G151100 · TK1151

Cytoplasm0.471

Rank 2 · TkA08G151100 · TK1151

Cell membrane0.042

Rank 3 · TkA08G151100 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA08G151100 · TK1151

Golgi apparatus0.025

Rank 5 · TkA08G151100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09405Btz24-35 aa

PF09405Btz117-208 aa

PF09405Btz333-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G151100	`PF09405`	Btz	24	35	1.2e-16	61.8
TkA08G151100	`PF09405`	Btz	117	208	1.2e-16	61.8
TkA08G151100	`PF09405`	Btz	333	353	1.2e-16	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW88`	Arabidopsis thaliana	sp\|Q9LW88\|NU50B_ARATH Nuclear pore complex protein NUP50B	42.800%	Swiss-Prot	Medium
`Q9C829`	Arabidopsis thaliana	sp\|Q9C829\|NU50A_ARATH Nuclear pore complex protein NUP50A	42.200%	Swiss-Prot	Medium
`Q93ZJ9`	Arabidopsis thaliana	sp\|Q93ZJ9\|MLN51_ARATH Protein MLN51 homolog	37.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card