Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2376 bp · TkA08G150180|TK1151|cDNA
CTGAATTCTGCAATACCAATTTTGTCCTCTTTCTAAGCAAAGGTTTTAGGTTTTTTGCATAAACCTTTATTAGTTAAAGCAATTTGCAGCTTCTTCACGTTATCTTCCTTCACATCTCTCTCTTTTCCAATCCCTATTTCTTATCTTTTCAGTTTCTTGAATTCAAGAACTGAGAAAGTGAGTGAGAGAGAGAGAGGTGTGGAGATGGAAGCTGTTCTTCAGACAAAAGGCCTTCTATCCCTTCCTTCAAACCCACAAAC...
1881 bp · TkA08G150180|TK1151|CDS
ATGGAAGCTGTTCTTCAGACAAAAGGCCTTCTATCCCTTCCTTCAAACCCACAAACCAGAGCTTTTCTCAACAAACCACCACCTCACCAATCTCTCCGACAACGATTCCATCTCCCAAATCCCTTAAAACCGAAATCCACAAATGGATTGTTTTCCTTAAATCTCGACGGCTGTAAAAAGTTCCAAGGGTTCGCTGCTACAAACCCTGGTTTGTTCGGCGCCCATAAACCCAAACTTTCTCATGTTTGTAAAGCTTCCGC...
Protein
Download Protein FASTA626 aa · TkA08G150180|TK1151|PROTEIN
MEAVLQTKGLLSLPSNPQTRAFLNKPPPHQSLRQRFHLPNPLKPKSTNGLFSLNLDGCKKFQGFAATNPGLFGAHKPKLSHVCKASAADAAVPGGAGYGEVEPPKFMGIEVLTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSKKALFYTVILPFIAFFGAFGFVLYPLSGYVHPTALADRLLEFLGPRFLGPLAIMRIWSFCLFYVMAELWGSVVVSVLFWG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G150180 |
|---|---|
| TK1151 ID | TkA08G150180 |
| OH-1004 ID | LXL04_032095 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G150180 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:39087585-39090459 (+) | |||||||||
| Description | Similar to Plastidic ATP/ADP-transporter | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0005471 ATP:ADP antiporter activity Molecular Function GO:0005524 ATP binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G15500 ath:AT1G80300 cmu:TC_0335 cpa:CP_0408 cpj:adt_1 cpn:CPn_0351 cpt:CpB0359 sot:102605062 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03219TLC105-575 aaPF31139LASP1NB122-128 aaPF07330DUF1467236-245 aaPF28839F59B103_C309-353 aaPF31139LASP1NB317-331 aaPF28880T2SSM_N320-335 aaPF07330DUF1467323-353 aaPF28839F59B103_C431-445 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G150180 | PF03219 | TLC | 105 | 575 | 2.4e-200 | 667.2 |
| TkA08G150180 | PF31139 | LASP1NB | 122 | 128 | 0.86 | 10.1 |
| TkA08G150180 | PF07330 | DUF1467 | 236 | 245 | 0.16 | 12.7 |
| TkA08G150180 | PF28839 | F59B103_C | 309 | 353 | 0.032 | 14.6 |
| TkA08G150180 | PF31139 | LASP1NB | 317 | 331 | 0.86 | 10.1 |
| TkA08G150180 | PF28880 | T2SSM_N | 320 | 335 | 0.093 | 13.5 |
| TkA08G150180 | PF07330 | DUF1467 | 323 | 353 | 0.16 | 12.7 |
| TkA08G150180 | PF28839 | F59B103_C | 431 | 445 | 0.032 | 14.6 |
| TkA08G150180 | PF28880 | T2SSM_N | 553 | 581 | 0.093 | 13.5 |
| TkA08G150180 | PF28839 | F59B103_C | 558 | 565 | 0.032 | 14.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.