TkA08G148930 | RubberDandelionOmics

Gene overview

TkA08G148930

Reference: TK1151 Chr: Chr08 Coordinates: 38790901-38792254 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1019 bp · TkA08G148930|TK1151|cDNA

CTCACTGTCATTTGACTCCTCTTCAATGATACAGTAAGTAAAATTATTCACCATGTCAATGGCTCTCAGCTTCTACAACAACTGGTCAAGTCATGACGCTGCCTACTCTTCTATTCTCCGGCCACCGTCACCACCACCGGAGCTGTTCACTTTCCATGAAGACTATACAATATTGTACGATAACCCACTTTTTGACCCTAACTACAGCAACAATGTAGAGGTAATTGAAATTCCCAGTTTAAAGTCGCCAAATTATTTCG...

CDS

Download CDS FASTA

855 bp · TkA08G148930|TK1151|CDS

ATGTCAATGGCTCTCAGCTTCTACAACAACTGGTCAAGTCATGACGCTGCCTACTCTTCTATTCTCCGGCCACCGTCACCACCACCGGAGCTGTTCACTTTCCATGAAGACTATACAATATTGTACGATAACCCACTTTTTGACCCTAACTACAGCAACAATGTAGAGGTAATTGAAATTCCCAGTTTAAAGTCGCCAAATTATTTCGATAATTTCCCACCAGGAATATCCACCGGAAATGTCTTTGCTCCGTCGCCGGA...

Protein

Download Protein FASTA

284 aa · TkA08G148930|TK1151|PROTEIN

MSMALSFYNNWSSHDAAYSSILRPPSPPPELFTFHEDYTILYDNPLFDPNYSNNVEVIEIPSLKSPNYFDNFPPGISTGNVFAPSPELHGSSYTYQAPYYNIPNSATFNHEHLSQFYTECTLTPELPSELPQLPEIYQGVGCAATLPPWSGSGRRNFIDEVEESCNVQLKRQNVGNGRGCLSAQSMAARVRRRKISEKTQELGKLIPGGHKMNTAEMFQAAFKYIKFLQAQIGVLKLMTSISETEEALGDGEMQALMTCT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G148930`
TK1151 ID	TkA08G148930
OH-1004 ID	LXL04_032084
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G148930

Location Chr08:38790901-38792254 (-)

Description Similar to BHLH52: Transcription factor bHLH52

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34820`	Transcription factor bHLH53.	No verified direct reference in this release
`At1g30670`	Transcription factor bHLH52.	No verified direct reference in this release
`At5g09750`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At3g21330`	Transcription factor bHLH87.	No verified direct reference in this release
`At3g50330`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032084 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009555 pollen development Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0022619 generative cell differentiation Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0048587 regulation of short-day photoperiodism, flowering Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G30670

ath:AT2G34820

ath:AT3G21330

ath:AT4G00120

dosa:Os05g0541400

osa:9269440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA08G148930 · TK1151

Cytoplasm0.104

Rank 2 · TkA08G148930 · TK1151

Cell membrane0.024

Rank 3 · TkA08G148930 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA08G148930 · TK1151

Plastid0.013

Rank 5 · TkA08G148930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH186-229 aa

PF23173bHLH_SAC51190-233 aa

PF23176bHLH_LHW192-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G148930	`PF00010`	HLH	186	229	1.4e-05	25.5
TkA08G148930	`PF23173`	bHLH_SAC51	190	233	0.0061	17.2
TkA08G148930	`PF23176`	bHLH_LHW	192	230	0.16	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84RD0`	Arabidopsis thaliana	sp\|Q84RD0\|BH053_ARATH Transcription factor bHLH53	51.500%	Swiss-Prot	Low
`Q9SA82`	Arabidopsis thaliana	sp\|Q9SA82\|BH052_ARATH Transcription factor bHLH52	60.600%	Swiss-Prot	Low
`Q9LXD8`	Arabidopsis thaliana	sp\|Q9LXD8\|HEC3_ARATH Transcription factor HEC3	43.400%	Swiss-Prot	Low
`Q8S3D2`	Arabidopsis thaliana	sp\|Q8S3D2\|BH087_ARATH Transcription factor bHLH87	44.400%	Swiss-Prot	Low
`Q9SND4`	Arabidopsis thaliana	sp\|Q9SND4\|HEC2_ARATH Transcription factor HEC2	47.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card