TkA08G145860 | RubberDandelionOmics

Gene overview

TkA08G145860

Reference: TK1151 Chr: Chr08 Coordinates: 38021531-38024630 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2442 bp · TkA08G145860|TK1151|cDNA

ACAGCTTGCAAGCGCTTATCAAGATTAAAAAGGCTAGAGAGCATAGCTCTTCCCTCTAACAATTTCAACAAGAGCATCATATCATGCCTTAGTGCCCTCCCATCCCTCAAGATTCTTGATCTTTCCTATAATTCTCCATTGGAAAAATTCCATAATTTGCCTAATTTGGAAGTCCTCTTCTTGAAAAGTAATGGTTTCAATGGAACACTGCCAATGGAAGCTTTCGCATCTTTGCACCATCTCGAGGTCTTAGATTTGAG...

CDS

Download CDS FASTA

2442 bp · TkA08G145860|TK1151|CDS

ACAGCTTGCAAGCGCTTATCAAGATTAAAAAGGCTAGAGAGCATAGCTCTTCCCTCTAACAATTTCAACAAGAGCATCATATCATGCCTTAGTGCCCTCCCATCCCTCAAGATTCTTGATCTTTCCTATAATTCTCCATTGGAAAAATTCCATAATTTGCCTAATTTGGAAGTCCTCTTCTTGAAAAGTAATGGTTTCAATGGAACACTGCCAATGGAAGCTTTCGCATCTTTGCACCATCTCGAGGTCTTAGATTTGAG...

Protein

Download Protein FASTA

813 aa · TkA08G145860|TK1151|PROTEIN

TACKRLSRLKRLESIALPSNNFNKSIISCLSALPSLKILDLSYNSPLEKFHNLPNLEVLFLKSNGFNGTLPMEAFASLHHLEVLDLSDNSFVGSIPSSIESLSSLRVVSFANNQLNGSLPNGFYELKNLRELDLRDNMLNGSLPQCFSSLSSLKMVDISSNQFTGILPPSLISNLTSLEYVDFSHNKFEGSFSFSSFSNHTKLEVVVFSSDNDKFEVETEEPRGWNPMFQLKILALSNCNINKRNGHVVPRFLLNQRELL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G145860`
TK1151 ID	TkA08G145860
OH-1004 ID	LXL04_032052
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	70.000
Protein coverage (%)	TK1151 99.754 / OH-1004 72.827 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G145860

Location Chr08:38021531-38024630 (-)

Description Similar to RLP56: Receptor-like protein 56

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74180`	Receptor-like protein 14.	No verified direct reference in this release
`At1g07390`	Involved in plant defense.	The receptor-like protein ReMAX of Arabidopsis detects the microbe-associated molecular pattern eMax from Xanthomonas.2013 · DOI: 10.1105/tpc.113.110833 Perception of the novel MAMP eMax from different Xanthomonas species requires the Arabidopsis receptor-like protein ReMAX and the receptor kinase SOBIR.2013 · DOI: 10.4161/psb.27408
`At1g74170`	Receptor-like protein 13.	No verified direct reference in this release
`At1g74190`	Receptor-like protein 15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032052 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G74170

ath:AT1G74190

ath:AT5G49290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.864

Rank 1 · TkA08G145860 · TK1151

Endoplasmic reticulum0.092

Rank 2 · TkA08G145860 · TK1151

Cytoplasm0.058

Rank 3 · TkA08G145860 · TK1151

Nucleus0.044

Rank 4 · TkA08G145860 · TK1151

Lysosome / Vacuole0.025

Rank 5 · TkA08G145860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23211LRR_LRWD16-66 aa

PF12799LRR_47-24 aa

PF25019LRR_R13L1-DRL217-62 aa

PF13855LRR_89-44 aa

PF12799LRR_411-55 aa

PF00560LRR_112-32 aa

PF29247LRR_MHP1-HER1-GIP312-111 aa

PF23598LRR_1425-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G145860	`PF23211`	LRR_LRWD1	6	66	0.00014	22.3
TkA08G145860	`PF12799`	LRR_4	7	24	1.5e-26	92.5
TkA08G145860	`PF25019`	LRR_R13L1-DRL21	7	62	0.027	15.1
TkA08G145860	`PF13855`	LRR_8	9	44	3.2e-42	142.8
TkA08G145860	`PF12799`	LRR_4	11	55	1.5e-26	92.5
TkA08G145860	`PF00560`	LRR_1	12	32	2.2e-43	137.6
TkA08G145860	`PF29247`	LRR_MHP1-HER1-GIP3	12	111	0.94	9.3
TkA08G145860	`PF23598`	LRR_14	25	134	5.3e-18	65.6
TkA08G145860	`PF24758`	LRR_At5g56370	28	45	0.38	11.1
TkA08G145860	`PF25013`	LRR_Zer-1	29	53	4e-05	24.5
TkA08G145860	`PF25013`	LRR_Zer-1	29	89	4e-05	24.5
TkA08G145860	`PF13516`	LRR_6	34	44	0.15	12.9
TkA08G145860	`PF00560`	LRR_1	35	45	2.2e-43	137.6
TkA08G145860	`PF25019`	LRR_R13L1-DRL21	47	111	0.027	15.1
TkA08G145860	`PF13855`	LRR_8	49	90	3.2e-42	142.8
TkA08G145860	`PF24758`	LRR_At5g56370	49	88	0.38	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HTV4`	Arabidopsis thaliana	sp\|F4HTV4\|RLP14_ARATH Receptor-like protein 14	38.400%	Swiss-Prot	Low
`Q9LNV9`	Arabidopsis thaliana	sp\|Q9LNV9\|RLP1_ARATH Receptor-like protein 1	40.300%	Swiss-Prot	Low
`Q9C6A6`	Arabidopsis thaliana	sp\|Q9C6A6\|RLP13_ARATH Receptor-like protein 13	35.600%	Swiss-Prot	Low
`Q9C6A8`	Arabidopsis thaliana	sp\|Q9C6A8\|RLP15_ARATH Receptor-like protein 15	40.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card