Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2157 bp · TkA08G145800|TK1151|cDNA
ACCTTTTTAGGACTTGAAAGGTTGTGGAGTTTGAAGAAGTTGGAGGTACTAGACCTTAGCGGGATTCATGATACTGATAACATCCTTCCATCATTGAGGACAATGAGTTCACTCAAAATCTTGGATCTTAGCAACACTGGCTTGACTGGAATCTTCCCCACCAATGAACTATCACATCTGACTAACCTGGAGGAGCTGAATTTAAGTTATAATCAGCTCGATGGCACACCAAATATCCAAGCTTGTAAGAGCTTATCGAG...
2157 bp · TkA08G145800|TK1151|CDS
ACCTTTTTAGGACTTGAAAGGTTGTGGAGTTTGAAGAAGTTGGAGGTACTAGACCTTAGCGGGATTCATGATACTGATAACATCCTTCCATCATTGAGGACAATGAGTTCACTCAAAATCTTGGATCTTAGCAACACTGGCTTGACTGGAATCTTCCCCACCAATGAACTATCACATCTGACTAACCTGGAGGAGCTGAATTTAAGTTATAATCAGCTCGATGGCACACCAAATATCCAAGCTTGTAAGAGCTTATCGAG...
Protein
Download Protein FASTA718 aa · TkA08G145800|TK1151|PROTEIN
TFLGLERLWSLKKLEVLDLSGIHDTDNILPSLRTMSSLKILDLSNTGLTGIFPTNELSHLTNLEELNLSYNQLDGTPNIQACKSLSRLERLASINLSYNNFNKTIISCLSALPSLKILDLSYSTSLGSSFPLQEFRNLPDLRILLLRENGFSGTLPTEAFASFRHLEVLDLKGNDFVGSIPSTIHVLSSLRALSLANNHLNGSLPDHGIGDLKNLHELDLSHNMLDGTLPQCLNSLSSLKMLDISSNQFSGILVPSIISN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G145800 |
|---|---|
| TK1151 ID | TkA08G145800 |
| OH-1004 ID | LXL04_032039 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 49.900 |
| Protein coverage (%) | TK1151 99.582 / OH-1004 84.483Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G145800 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:37999125-38004085 (-) | |||||||||
| Description | Similar to RLP13: Receptor-like protein 13 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0009791 post-embryonic development Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045087 innate immune response Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0004672 protein kinase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G07390 ath:AT1G74170 ath:AT1G74190 ath:AT5G49290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23952LRR_EndoS4-74 aaPF13855LRR_88-21 aaPF12799LRR_48-24 aaPF24758LRR_At5g563708-70 aaPF23211LRR_LRWD19-71 aaPF23598LRR_1410-152 aaPF25013LRR_Zer-110-75 aaPF25019LRR_R13L1-DRL2110-45 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G145800 | PF23952 | LRR_EndoS | 4 | 74 | 0.56 | 11.2 |
| TkA08G145800 | PF13855 | LRR_8 | 8 | 21 | 2.5e-48 | 162.4 |
| TkA08G145800 | PF12799 | LRR_4 | 8 | 24 | 1.2e-33 | 115.1 |
| TkA08G145800 | PF24758 | LRR_At5g56370 | 8 | 70 | 0.0049 | 17.3 |
| TkA08G145800 | PF23211 | LRR_LRWD1 | 9 | 71 | 1.9e-08 | 35.0 |
| TkA08G145800 | PF23598 | LRR_14 | 10 | 152 | 4.1e-31 | 108.8 |
| TkA08G145800 | PF25013 | LRR_Zer-1 | 10 | 75 | 7.2e-07 | 30.1 |
| TkA08G145800 | PF25019 | LRR_R13L1-DRL21 | 10 | 45 | 9.9e-05 | 23.0 |
| TkA08G145800 | PF13516 | LRR_6 | 12 | 21 | 2.4e-08 | 34.1 |
| TkA08G145800 | PF00560 | LRR_1 | 13 | 34 | 6e-42 | 133.3 |
| TkA08G145800 | PF29247 | LRR_MHP1-HER1-GIP3 | 17 | 97 | 0.004 | 17.1 |
| TkA08G145800 | PF24141 | LRR_ComC | 27 | 76 | 0.0008 | 19.9 |
| TkA08G145800 | PF18016 | SAM_3 | 27 | 60 | 0.15 | 12.7 |
| TkA08G145800 | PF13855 | LRR_8 | 33 | 73 | 2.5e-48 | 162.4 |
| TkA08G145800 | PF13516 | LRR_6 | 36 | 49 | 2.4e-08 | 34.1 |
| TkA08G145800 | PF00560 | LRR_1 | 37 | 54 | 6e-42 | 133.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.