TkA08G144250 | RubberDandelionOmics

Gene overview

TkA08G144250

Reference: TK1151 Chr: Chr08 Coordinates: 37619845-37621008 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · TkA08G144250|TK1151|cDNA

ATGGTCTGGCAAATACACGGGGACTGTATAGAAGAGGAGAGAAAGGCACTACTAGAAATTAAAGCCTCCTATATCAAGACATATGATTCAAAAATTGACTATTTTCTCCCTACCTGGGTTGATTATGGCAATAGTACCCTTAAAAATGGTGGCGGGGACTGTTGTGATTGGGAGAGGATCAGCTGCAACACAACCACCGGTCATATCACAGACGTTTCTTTGAGCAGATTGAGAGGGTTAGACGTGTACTGGGGAGATGG...

CDS

Download CDS FASTA

633 bp · TkA08G144250|TK1151|CDS

ATGGTCTGGCAAATACACGGGGACTGTATAGAAGAGGAGAGAAAGGCACTACTAGAAATTAAAGCCTCCTATATCAAGACATATGATTCAAAAATTGACTATTTTCTCCCTACCTGGGTTGATTATGGCAATAGTACCCTTAAAAATGGTGGCGGGGACTGTTGTGATTGGGAGAGGATCAGCTGCAACACAACCACCGGTCATATCACAGACGTTTCTTTGAGCAGATTGAGAGGGTTAGACGTGTACTGGGGAGATGG...

Protein

Download Protein FASTA

210 aa · TkA08G144250|TK1151|PROTEIN

MVWQIHGDCIEEERKALLEIKASYIKTYDSKIDYFLPTWVDYGNSTLKNGGGDCCDWERISCNTTTGHITDVSLSRLRGLDVYWGDGSKLWSLNVSLFLHFRELTSLDLSDAYLDKEILKTGLERLSSLKKLEVLDLNSNYEIDNDILPSLRVLTSLKILDLSYTSLSGDLLIHFAALENLEVLNLTECEFTGTLNIQGSQDHLKLIMPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G144250`
TK1151 ID	TkA08G144250
OH-1004 ID	LXL04_032039
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.100
Protein coverage (%)	TK1151 98.095 / OH-1004 20.962 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G144250

Location Chr08:37619845-37621008 (+)

Description Similar to RLP13: Receptor-like protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58190`	Receptor-like protein 9a.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032039 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G07390

ath:AT1G74170

ath:AT1G74190

ath:AT5G49290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.421

Rank 1 · TkA08G144250 · TK1151

Endoplasmic reticulum0.219

Rank 2 · TkA08G144250 · TK1151

Extracellular0.127

Rank 3 · TkA08G144250 · TK1151

Cytoplasm0.118

Rank 4 · TkA08G144250 · TK1151

Nucleus0.085

Rank 5 · TkA08G144250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_211-63 aa

PF12799LRR_454-73 aa

PF13855LRR_868-80 aa

PF23952LRR_EndoS71-111 aa

PF23598LRR_1474-108 aa

PF25019LRR_R13L1-DRL2176-134 aa

PF13855LRR_887-140 aa

PF23247LRR_RPS289-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G144250	`PF08263`	LRRNT_2	11	63	9.4e-06	26.5
TkA08G144250	`PF12799`	LRR_4	54	73	2.8e-06	28.1
TkA08G144250	`PF13855`	LRR_8	68	80	1.8e-05	25.1
TkA08G144250	`PF23952`	LRR_EndoS	71	111	0.017	16.0
TkA08G144250	`PF23598`	LRR_14	74	108	0.0028	17.2
TkA08G144250	`PF25019`	LRR_R13L1-DRL21	76	134	0.014	16.1
TkA08G144250	`PF13855`	LRR_8	87	140	1.8e-05	25.1
TkA08G144250	`PF23247`	LRR_RPS2	89	140	0.31	11.7
TkA08G144250	`PF25013`	LRR_Zer-1	98	168	0.019	15.8
TkA08G144250	`PF24758`	LRR_At5g56370	98	137	0.077	13.3
TkA08G144250	`PF12799`	LRR_4	100	111	2.8e-06	28.1
TkA08G144250	`PF29594`	LRR_SKP2	102	161	0.027	14.4
TkA08G144250	`PF00560`	LRR_1	104	118	7.7e-06	25.8
TkA08G144250	`PF13516`	LRR_6	104	111	0.0014	19.3
TkA08G144250	`PF23952`	LRR_EndoS	121	187	0.017	16.0
TkA08G144250	`PF12799`	LRR_4	122	144	2.8e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I9S3`	Arabidopsis thaliana	sp\|F4I9S3\|RLP9A_ARATH Receptor-like protein 9a	34.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card