TkA08G142140 | RubberDandelionOmics

Gene overview

TkA08G142140

Reference: TK1151 Chr: Chr08 Coordinates: 37060933-37061292 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA08G142140|TK1151|cDNA

ATGTCCGAGTCGTCATCAGAAGAATATCTAGGTATAAATCAAACAGAAATTGGGCAATCAAGTCAATTTCATGAATCTTCCATAGTCTATGTCCAAGGCTACAAGGTTAAGAACAGCATCGCCCCGATTCTCGAAGCCATTTTTAAGAAACACGGTGACATAGCAGCTCAATATGTATTCAAAACAGATTCCGTTCGGGCATCTTTCCTGGAGCTTGTTTGTGACGTCGTCAGGCAGCTTCAAAACGACGATGAAACAAC...

CDS

Download CDS FASTA

360 bp · TkA08G142140|TK1151|CDS

ATGTCCGAGTCGTCATCAGAAGAATATCTAGGTATAAATCAAACAGAAATTGGGCAATCAAGTCAATTTCATGAATCTTCCATAGTCTATGTCCAAGGCTACAAGGTTAAGAACAGCATCGCCCCGATTCTCGAAGCCATTTTTAAGAAACACGGTGACATAGCAGCTCAATATGTATTCAAAACAGATTCCGTTCGGGCATCTTTCCTGGAGCTTGTTTGTGACGTCGTCAGGCAGCTTCAAAACGACGATGAAACAAC...

Protein

Download Protein FASTA

119 aa · TkA08G142140|TK1151|PROTEIN

MSESSSEEYLGINQTEIGQSSQFHESSIVYVQGYKVKNSIAPILEAIFKKHGDIAAQYVFKTDSVRASFLELVCDVVRQLQNDDETTTISKIEEIESKITETQTANIHVSWLRSHLDVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G142140`
TK1151 ID	TkA08G142140
OH-1004 ID	LXL04_032021
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.700
Protein coverage (%)	TK1151 78.151 / OH-1004 11.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G142140`
Location	Chr08:37060933-37061292 (-)
Description	Similar to SDF2: Stromal cell-derived factor 2-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032021` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002221 pattern recognition receptor signaling pathway Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0009556 microsporogenesis Biological Process GO:0010468 regulation of gene expression Biological Process GO:0035825 homologous recombination Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0051301 cell division Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT1G80810 ath:AT2G25110 ath:AT4G31880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · TkA08G142140 · TK1151

Cytoplasm0.203

Rank 2 · TkA08G142140 · TK1151

Cell membrane0.018

Rank 3 · TkA08G142140 · TK1151

Mitochondrion0.014

Rank 4 · TkA08G142140 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA08G142140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05278PEARLI-425-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G142140	`PF05278`	PEARLI-4	25	117	3.2e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card