RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G138930
Reference: TK1151 Chr: Chr08 Coordinates: 36147136-36151140 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3087 bp · TkA08G138930|TK1151|cDNA

ATATCTTCCCTTGACCAAGCAAAAAGCCAAAATAAGATGTCGTTTTAGATATGGTTCATCACCCCGGGAGTAGAAACCCGCTCCAAGTAACCGGAAATACCCGGTCACCACTCGGGTGTTGTTAGAATTTGGACCACCGGTTGAAATTACTGCAAACACCAGTTTTGACCTCCAACCAGTCGATGAATATCTTCTTTTGCTCTCGGAATTTCCATAGTTTAGAGAGAGAAAGTCCATCTGATTGTTGATGTAGATGTTTC...

CDS

Download CDS FASTA

2202 bp · TkA08G138930|TK1151|CDS

ATGACATCTTCGGAGGCTTCAAGCAAAGGTAATAACATGAGAGGAGACAGAGACACGTTTTCTTTGTCTGGTTTTAGCGACAAAAATGATGCGGTAGGTGATTCAAGAGCTGTTCCAGCGGTTTCCGGTGCCGGAAAAGTTGATGCGGATATGGCTCTTTACAAGGAGCTCTGGCGAGCATGTGCTGGTCCGCTCGTTACTGTACCTCGCGAAAATGAGCTAGTGTTTTATTTTCCTCAAGGACACATCGAACAGGTTGA...

Protein

Download Protein FASTA

733 aa · TkA08G138930|TK1151|PROTEIN

MTSSEASSKGNNMRGDRDTFSLSGFSDKNDAVGDSRAVPAVSGAGKVDADMALYKELWRACAGPLVTVPRENELVFYFPQGHIEQVEASTNQVAEQQMPMYNLPSKILCRVVNVQLKAEQETDEVFAQITLMPEADQDETTVKKEPPPPPQSRFQVHSFCKTLTASDTSTHGGFSVLRRHADECLPQLDMSRQPPTQELVAKDLHSTEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G138930
TK1151 IDTkA08G138930
OH-1004 IDLXL04_031971
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 97.603
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G138930
LocationChr08:36147136-36151140 (-)
DescriptionSimilar to ARF2B: Auxin response factor 2B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g62000 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
AUXIN RESPONSE FACTOR 2 (ARF2): a pleiotropic developmental regulator.2005 · DOI: 10.1111/j.1365-313x.2005.02426.x
AUXIN RESPONSE FACTOR1 and AUXIN RESPONSE FACTOR2 regulate senescence and floral organ abscission in Arabidopsis thaliana.2005 · DOI: 10.1242/dev.02012
The AUXIN RESPONSE FACTOR 2 gene of Arabidopsis links auxin signalling, cell division, and the size of seeds and other organs.2006 · DOI: 10.1242/dev.02194

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0523800 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
UniProt: A2ZET6 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Os12g0479400 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031971 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0008219 cell death Biological Process
GO:0008285 negative regulation of cell population proliferation Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009835 fruit ripening Biological Process
GO:0009836 fruit ripening, climacteric Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010047 fruit dehiscence Biological Process
GO:0010150 leaf senescence Biological Process
KEGG gene cross-reference
ath:AT1G59750
ath:AT5G62000
dosa:Os01g0927600
sly:778240
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970
Rank 1 · TkA08G138930 · TK1151
Cytoplasm0.080
Rank 2 · TkA08G138930 · TK1151
Cell membrane0.032
Rank 3 · TkA08G138930 · TK1151
Endoplasmic reticulum0.018
Rank 4 · TkA08G138930 · TK1151
Plastid0.014
Rank 5 · TkA08G138930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25313BRWD_AD69-121 aa
PF02362B3159-260 aa
PF25313BRWD_AD289-390 aa
PF01383CpcD297-318 aa
PF06507ARF_AD308-390 aa
PF02309AUX_IAA579-645 aa
PF00884Sulfatase599-669 aa
PF02362B3653-680 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G138930PF25313BRWD_AD691215.8e-1246.7
TkA08G138930PF02362B31592601.8e-2279.9
TkA08G138930PF25313BRWD_AD2893905.8e-1246.7
TkA08G138930PF01383CpcD2973180.2312.5
TkA08G138930PF06507ARF_AD3083902.4e-36124.2
TkA08G138930PF02309AUX_IAA5796451.5e-1351.8
TkA08G138930PF00884Sulfatase5996690.02914.4
TkA08G138930PF02362B36536801.8e-2279.9
TkA08G138930PF02309AUX_IAA6546911.5e-1351.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94JM3Arabidopsis thalianasp|Q94JM3|ARFB_ARATH Auxin response factor 255.600%Swiss-ProtHigh
Q2R3F5Oryza sativa subsp. japonicasp|Q2R3F5|ARFW_ORYSJ Auxin response factor 2352.800%Swiss-ProtHigh
A2ZET6Oryza sativa subsp. indicasp|A2ZET6|ARFW_ORYSI Auxin response factor 2353.100%Swiss-ProtHigh
Q2QQX6Oryza sativa subsp. japonicasp|Q2QQX6|ARFX_ORYSJ Auxin response factor 2448.400%Swiss-ProtMedium

JBrowse

View in Genome Browser