TkA08G117500 | RubberDandelionOmics

Gene overview

TkA08G117500

Reference: TK1151 Chr: Chr08 Coordinates: 30631115-30631872 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

537 bp · TkA08G117500|TK1151|cDNA

ATGTCCGGCATCCGCTACCGCTTTCTCACAGTTTCTTCCTTCACCGTATCACATTCTTCCACTAAGTTCTCCGTCAGATTCAACGTCTCATGCTGCATCTCCTCGTCGCCGGTGACCATCGTCAATGGAAACGTCGACGTGAAATCAGCAGACAGGAATGAAATTAGATTAGGTTTGCCAAGTAAAGGTCGAATGGCTACCGATACGCTTGATCTTCTTAAAGATTGTCAATTATCGGTGAGGCAACTTAATCCACGGCA...

CDS

Download CDS FASTA

537 bp · TkA08G117500|TK1151|CDS

ATGTCCGGCATCCGCTACCGCTTTCTCACAGTTTCTTCCTTCACCGTATCACATTCTTCCACTAAGTTCTCCGTCAGATTCAACGTCTCATGCTGCATCTCCTCGTCGCCGGTGACCATCGTCAATGGAAACGTCGACGTGAAATCAGCAGACAGGAATGAAATTAGATTAGGTTTGCCAAGTAAAGGTCGAATGGCTACCGATACGCTTGATCTTCTTAAAGATTGTCAATTATCGGTGAGGCAACTTAATCCACGGCA...

Protein

Download Protein FASTA

178 aa · TkA08G117500|TK1151|PROTEIN

MSGIRYRFLTVSSFTVSHSSTKFSVRFNVSCCISSSPVTIVNGNVDVKSADRNEIRLGLPSKGRMATDTLDLLKDCQLSVRQLNPRQYVADIPQLSNVEVWFQPPKDIVRKLVSGDLDLGIVGLDIVSEFGQVRIKKHHMNIMSHPQTCRRKHLRVGTSCTYHNTFTNSTNIVFNSFH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G117500`
TK1151 ID	TkA08G117500
OH-1004 ID	LXL04_021293
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 74.157 / OH-1004 54.772 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G117500

Location Chr08:30631115-30631872 (+)

Description Similar to HISN1B: ATP phosphoribosyltransferase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09795`	Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP).	No verified direct reference in this release
`At1g58080`	Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0134300`	Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000105 L-histidine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003879 ATP phosphoribosyltransferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G09795

ath:AT1G58080

dosa:Os03g0134300

mes:Meso_0419

oan:Oant_3019

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.895

Rank 1 · TkA08G117500 · TK1151

Mitochondrion0.093

Rank 2 · TkA08G117500 · TK1151

Nucleus0.062

Rank 3 · TkA08G117500 · TK1151

Cytoplasm0.037

Rank 4 · TkA08G117500 · TK1151

Peroxisome0.013

Rank 5 · TkA08G117500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01634HisG105-132 aa

PF25173Beta-prop_WDR3_1st110-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G117500	`PF01634`	HisG	105	132	0.0023	18.6
TkA08G117500	`PF25173`	Beta-prop_WDR3_1st	110	145	0.066	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GSJ1`	Arabidopsis thaliana	sp\|Q8GSJ1\|HIS1B_ARATH ATP phosphoribosyltransferase 2, chloroplastic	71.400%	Swiss-Prot	Medium
`Q9S762`	Arabidopsis thaliana	sp\|Q9S762\|HIS1A_ARATH ATP phosphoribosyltransferase 1, chloroplastic	79.300%	Swiss-Prot	Low
`Q10S55`	Oryza sativa subsp. japonica	sp\|Q10S55\|HIS1_ORYSJ ATP phosphoribosyltransferase, chloroplastic	78.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card