TkA08G088750 | RubberDandelionOmics

Gene overview

TkA08G088750

Reference: TK1151 Chr: Chr08 Coordinates: 22986890-22989514 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1525 bp · TkA08G088750|TK1151|cDNA

GATCGGCTTAGTTTGAGCCGTCTCACTTTTTCCTTTAGCCGTTTGTTAGCCGCGTTGATGAGCCGCTTCGCTTTTCCCTTTACCTGTTTGTTACCACCTCTTCTATACACCTGTCTTTCTTTCTTCTTATCATCATCCTCTTCTTTCCCTTCGTGTCTTCATCTCCTTGCTCCGCCGTCTCCTTCTTATCTTTTATCCACGCCTTAAATTCGATCTTACCTTCGCTTCTTTTTATTTACTCCTCTTCCTTTGTTCTTCCG...

CDS

Download CDS FASTA

687 bp · TkA08G088750|TK1151|CDS

ATGAAACCAGTGGAGAGGAATCCAATGGAAATCAATAACCTCTTGGCCCCTTTACAGTCAAATACAGTTTCAATCACTTCTTCACAGGAGTATGGATGCTTAAGGAAAAAGAAAATAGATGAACTTACCGAGGTGCAAAATGATGTCCAGTATATAAAAGATGACATTAGTTTGGTGGAAAGACATAGAATCAACTTGTATAGAGCTAGAGATAGGTATTTAGTGAAAATTCCAGTTCATGGTGGTGAGCTTACAGGTTC...

Protein

Download Protein FASTA

228 aa · TkA08G088750|TK1151|PROTEIN

MKPVERNPMEINNLLAPLQSNTVSITSSQEYGCLRKKKIDELTEVQNDVQYIKDDISLVERHRINLYRARDRYLVKIPVHGGELTGSKTWSSSSINKDTILFPSGKPQGSTQMKEASSGLSSQHTNQSSLAVTLKKRVQSEFNDLQHCYLQKRRQVPNPLQNHDKRDDDVIQREGIVQVYQIFNLYFPLLHNIELRHGELFHSANIVSSIEFHRDDEVFATAGVSRRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G088750`
TK1151 ID	TkA08G088750
OH-1004 ID	LXL04_031138
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 86.038 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G088750

Location Chr08:22986890-22989514 (+)

Description Similar to COP1: E3 ubiquitin-protein ligase COP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32950`	E3 ubiquitin-protein ligase that acts as a repressor of photomorphogenesis and as an activator of etiolation in darkness.	Two interacting bZIP proteins are direct targets of COP1-mediated control of light-dependent gene expression in Arabidopsis.2002 · DOI: 10.1101/gad.969702 Short Hypocotyl in White Light1 Interacts with Elongated Hypocotyl5 (HY5) and Constitutive Photomorphogenic1 (COP1) and Promotes COP1-Mediated Degradation of HY5 during Arabidopsis Seedling Development.2015 · DOI: 10.1104/pp.15.01184 PHYTOCHROME INTERACTING FACTOR8 Inhibits Phytochrome A-Mediated Far-Red Light Responses in Arabidopsis.2020 · DOI: 10.1105/tpc.19.00515 Role of a COP1 interactive protein in mediating light-regulated gene expression in arabidopsis.1998 · DOI: 10.1105/tpc.10.7.1083

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009641 shade avoidance Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0010224 response to UV-B Biological Process

GO:0016567 protein ubiquitination Biological Process

KEGG gene cross-reference

ath:AT2G32950

hsa:64326

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.727

Rank 1 · TkA08G088750 · TK1151

Cytoplasm0.280

Rank 2 · TkA08G088750 · TK1151

Mitochondrion0.044

Rank 3 · TkA08G088750 · TK1151

Cell membrane0.032

Rank 4 · TkA08G088750 · TK1151

Lysosome / Vacuole0.020

Rank 5 · TkA08G088750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43254`	Arabidopsis thaliana	sp\|P43254\|COP1_ARATH E3 ubiquitin-protein ligase COP1	47.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card