TkA08G078750 | RubberDandelionOmics

Gene overview

TkA08G078750

Reference: TK1151 Chr: Chr08 Coordinates: 20221061-20227820 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA08G078750|TK1151|cDNA

TCTCAAACAAGAACAACAGCATCCACTCAAAATCCTCCGAATCAAAAGTTCAAAACCTTCGAACTTCAATTACTAACTTTTTCATCATCATCTCAAATCCCGTGAAAAATGGCAAGTTGTAGTATGGCATTTGCTGCTTCAAGCTTCGTGGTGACACCAAATGTCACCTCCAATTCAACCACCGTCAAGGGCAATATGGTCTTTTTACCTTTGCAAAACAAAAGAGCTTCAAGACTTGTTGTGAGGGCGGCTGAAGAACC...

CDS

Download CDS FASTA

465 bp · TkA08G078750|TK1151|CDS

ATGGCAAGTTGCAGTATACCATCTGCTGCTTCAAGCTTCGTGGTGACACCAAATGTCACCTCCAATTCAACCACCGTCAAGGGCAATATGGTCTTTTTACATTTGCAAAACAAAAGAGCTTCAAGACTTGTTGTTAGGGCGGCGGAAGAACCGGCTGCCACCGCTGAGCTAGCCAAGGTTGAGACACCTAAGCCACCGCCGATTGGACCCAAGAGAGGATCTAAGGTGAGAATCATGAGGAAGGAGTCTTACTGGTTCAA...

Protein

Download Protein FASTA

154 aa · TkA08G078750|TK1151|PROTEIN

MASCSIPSAASSFVVTPNVTSNSTTVKGNMVFLHLQNKRASRLVVRAAEEPAATAELAKVETPKPPPIGPKRGSKVRIMRKESYWFKGVGSVVTVDQVFQPTTMHWMRSKKFRISFLFILPTHLNLLLLIDQWICIIFYNSVSLVPRFVSYYIC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G078750`
TK1151 ID	TkA08G078750
OH-1004 ID	LXL04_018701
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 59.740 / OH-1004 39.485 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G078750

Location Chr08:20221061-20227820 (+)

Description Similar to PSAEA: Photosystem I reaction center subunit IV A, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20260`	Stabilizes the interaction between PsaC and the PSI core, assists the docking of the ferredoxin to PSI and interacts with ferredoxin-NADP oxidoreductase.	No verified direct reference in this release
`At4g28750`	Stabilizes the interaction between PsaC and the PSI core, assists the docking of the ferredoxin to PSI and interacts with ferredoxin-NADP oxidoreductase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018701 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009538 photosystem I reaction center Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0019904 protein domain specific binding Molecular Function

GO:0051219 phosphoprotein binding Molecular Function

KEGG gene cross-reference

ath:AT2G20260

nsy:104243298

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · TkA08G078750 · TK1151

Mitochondrion0.031

Rank 2 · TkA08G078750 · TK1151

Nucleus0.027

Rank 3 · TkA08G078750 · TK1151

Cytoplasm0.015

Rank 4 · TkA08G078750 · TK1151

Cell membrane0.009

Rank 5 · TkA08G078750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02427PSI_PsaE71-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G078750	`PF02427`	PSI_PsaE	71	97	2.2e-12	47.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S714`	Arabidopsis thaliana	sp\|Q9S714\|PSAE2_ARATH Photosystem I reaction center subunit IV B, chloroplastic	57.500%	Swiss-Prot	High
`Q9S831`	Arabidopsis thaliana	sp\|Q9S831\|PSAE1_ARATH Photosystem I reaction center subunit IV A, chloroplastic	55.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card