TkA08G068270 | RubberDandelionOmics

Gene overview

TkA08G068270

Reference: TK1151 Chr: Chr08 Coordinates: 17535645-17537084 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1177 bp · TkA08G068270|TK1151|cDNA

AAGCTTTACTTTCCACCCAAGGAAATAAAGTTTTAAATTTTATGTTGCATAAAACCCGTTAATATGCGTGGAGAAATGATGTTAGTCCAAGAAAGAAGGCAAACGAGAAGTTGCAGAGATTAGAAAAAACGCAAAAAGATTCCACAATTCACTTCCATACCCATCAAATTGATAAATTCCCATTTTGTTCTTACTCACTGAACAATAATCTGGACGCATTCAGATACAGATCCCTCTGTTTCTACTTATTCCCACCCCAA...

CDS

Download CDS FASTA

501 bp · TkA08G068270|TK1151|CDS

ATGGATGAGAATTTAGGAACCAAGCTGAATGGTATCAGACAGATTGTTAAGCTTAAAGAAATCATCCAAAGATGGCAACATGTAACACTTGGGGGAAAGGGAAATGATGACGATGATGATGCTAATAACAATCCGGCTATGGGTAATCGTCATCCAGGTGTAGGAATTAATCCGGCAATAAGCATGAGGCTGAAGGGTTACAGTGTCTATTCCGATTCAGACATTGAAGACGGTTGCCAAAGCCCTGATCCACCAAACGA...

Protein

Download Protein FASTA

166 aa · TkA08G068270|TK1151|PROTEIN

MDENLGTKLNGIRQIVKLKEIIQRWQHVTLGGKGNDDDDDANNNPAMGNRHPGVGINPAISMRLKGYSVYSDSDIEDGCQSPDPPNDVPKGYLAVYVGPELRRFIIPTSYLSDPLFKVLLQKVEEEFGFDHSGGLTIPCEIETFKYLLNCMEHHQKDHLEDNHAKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G068270`
TK1151 ID	TkA08G068270
OH-1004 ID	LXL04_018565
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 79.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G068270

Location Chr08:17535645-17537084 (-)

Description Similar to ARG7: Indole-3-acetic acid-induced protein ARG7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19830`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018565 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009639 response to red or far red light Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G19830

gmx:100775873

gmx:100787768

gmx:100815976

gmx:100817568

gmx:106798973

gmx:113001958

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.406

Rank 1 · TkA08G068270 · TK1151

Nucleus0.334

Rank 2 · TkA08G068270 · TK1151

Cell membrane0.293

Rank 3 · TkA08G068270 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA08G068270 · TK1151

Plastid0.054

Rank 5 · TkA08G068270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519Auxin_inducible58-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G068270	`PF02519`	Auxin_inducible	58	154	1e-25	90.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXI0`	Arabidopsis thaliana	sp\|Q9FXI0\|SAU54_ARATH Protein SMALL AUXIN UP-REGULATED RNA 54	49.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card