TkA08G057160 | RubberDandelionOmics

Gene overview

TkA08G057160

Reference: TK1151 Chr: Chr08 Coordinates: 14604774-14606192 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA08G057160|TK1151|cDNA

GGGAACTTTACCGCCTCTTATTCACTTAGGGCTCAAAATATATCAACACAATTCAAAGAATTTTCAATCTGCCTGTGCATCTCAAACCGTCTCCCCGAAAAGCATTTTCTGATCGACTCATCTCACGGCAAACAGTGTTTGTAGGAGATGGATACAACGAATCCAGCTGTCATTGTTAATGGCGATCTGCTTCGCAGTTACGTGGGAAGAAAAGTACGAACAGTGATTCAGGTAATAAGGCCTGATGCTGGTGGTCTAAT...

CDS

Download CDS FASTA

321 bp · TkA08G057160|TK1151|CDS

ATGGATACAACGAATCCAGCTGTCATTGTTAATGGCGATCTGCTTCGCAGTTACGTGGGAAGAAAAGTACGAACAGTGATTCAGGTAATAAGGCCTGATGCTGGTGGTCTAATTGGGAGATCGACAGATGAAAAGCAAATTACTATAAAGGGCCAGCCTCCATCTCCTCTTACTACTTTTGTTGAAGTAATCGGTGTTGCTGATAGTGCACTATCCATTCGCGCAGAGATCGTGACCAACTTTGGTGATACTTTTGATAC...

Protein

Download Protein FASTA

106 aa · TkA08G057160|TK1151|PROTEIN

MDTTNPAVIVNGDLLRSYVGRKVRTVIQVIRPDAGGLIGRSTDEKQITIKGQPPSPLTTFVEVIGVADSALSIRAEIVTNFGDTFDTNNYNQLCQLANGEFRHLFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G057160`
TK1151 ID	TkA08G057160
OH-1004 ID	LXL04_018360
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 68.831 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G057160

Location Chr08:14604774-14606192 (-)

Description Similar to RPA3B: Replication protein A 14 kDa subunit B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18590`	As part of the replication protein A (RPA/RP-A), a single-stranded DNA-binding heterotrimeric complex, may play an essential role in DNA replication, recombination and repair.	No verified direct reference in this release
`At3g52630`	As part of the replication protein A (RPA/RP-A), a single-stranded DNA-binding heterotrimeric complex, may play an essential role in DNA replication, recombination and repair.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0253600`	As part of the replication protein A (RPA/RP-A), a single-stranded DNA-binding heterotrimeric complex, may play an essential role in DNA replication, recombination and repair.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018360 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0031981 nuclear lumen Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G52630

ath:AT4G18590

dosa:Os01g0253600

osa:4327706

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.751

Rank 1 · TkA08G057160 · TK1151

Cytoplasm0.473

Rank 2 · TkA08G057160 · TK1151

Mitochondrion0.026

Rank 3 · TkA08G057160 · TK1151

Cell membrane0.024

Rank 4 · TkA08G057160 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA08G057160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08661Rep_fac-A_31-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G057160	`PF08661`	Rep_fac-A_3	1	101	2.1e-23	83.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLG7`	Arabidopsis thaliana	sp\|Q6NLG7\|RFA3B_ARATH Replication protein A 14 kDa subunit B	66.000%	Swiss-Prot	High
`Q9LXK1`	Arabidopsis thaliana	sp\|Q9LXK1\|RFA3A_ARATH Replication protein A 14 kDa subunit A	62.600%	Swiss-Prot	High
`Q9SDK9`	Oryza sativa subsp. japonica	sp\|Q9SDK9\|RFA3_ORYSJ Replication protein A 14 kDa subunit	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card