TkA08G043730 | RubberDandelionOmics

Gene overview

TkA08G043730

Reference: TK1151 Chr: Chr08 Coordinates: 11164116-11166474 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

739 bp · TkA08G043730|TK1151|cDNA

AAATCTGTCATTCTTCATACTGATTCTTTTTTAACAAATGCACGCGGGTACCCTTGTCTATCCAAACGTCATCAGAACCTTCTCAGCAGTTTCTTTTACTATTCAGTACAGATAGTGTTTTCTGGAAAGGCAGTGCACAAAGTTGCTGCTTCTGGTGCTACCCAACCCGATGCCCAACAAGCTCAGAGACATGAATTAAGGTCATACATGGAACCCCTTCCAGAACAAGAACGATTTGAGCCTCTCATGGATAATTTAGA...

CDS

Download CDS FASTA

477 bp · TkA08G043730|TK1151|CDS

AAATCTGTCATTCTTCATACTGATTCTTTTTTAACAAATGCACGCGGGTACCCTTGTCTATCCAAACGTCATCAGAACCTTCTCAGCAGTTTCTTTTACTATTCAGTACAGATAGTGTTTTCTGGAAAGGCAGTGCACAAAGTTGCTGCTTCTGGTGCTACCCAACCCGATGCCCAACAAGCTCAGAGACATGAATTAAGGTCATACATGGAACCCCTTCCAGAACAAGAACGATTTGAGCCTCTCATGGATAATTTAGA...

Protein

Download Protein FASTA

158 aa · TkA08G043730|TK1151|PROTEIN

KSVILHTDSFLTNARGYPCLSKRHQNLLSSFFYYSVQIVFSGKAVHKVAASGATQPDAQQAQRHELRSYMEPLPEQERFEPLMDNLEAQTYEIFEKDSVKYIQYQRAVSKALLDRISDENASTTTVVLMVVGVGRGPLVRASLQVHKFHTACDYIKVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G043730`
TK1151 ID	TkA08G043730
OH-1004 ID	LXL04_026567
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.100
Protein coverage (%)	TK1151 100.000 / OH-1004 37.890 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G043730

Location Chr08:11164116-11166474 (-)

Description Similar to PRMT5: Protein arginine N-methyltransferase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31120`	Methylates arginine residues of myelin basic protein (MBP) in vitro.	SKB1-mediated symmetric dimethylation of histone H4R3 controls flowering time in Arabidopsis.2007 · DOI: 10.1038/sj.emboj.7601647

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X0Q3`	Methylates arginine residues in proteins such as histone H4.	No verified direct reference in this release
`Os02g0139200`	Methylates arginine residues in proteins such as histone H4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008276 protein methyltransferase activity Molecular Function

GO:0016274 protein-arginine N-methyltransferase activity Molecular Function

GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G31120

dosa:Os02g0139200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · TkA08G043730 · TK1151

Nucleus0.471

Rank 2 · TkA08G043730 · TK1151

Mitochondrion0.071

Rank 3 · TkA08G043730 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA08G043730 · TK1151

Cell membrane0.064

Rank 5 · TkA08G043730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17285PRMT5_TIM2-103 aa

PF12434Malate_DH53-67 aa

PF15871JMY59-93 aa

PF05185PRMT576-150 aa

PF12434Malate_DH138-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G043730	`PF17285`	PRMT5_TIM	2	103	1e-11	45.4
TkA08G043730	`PF12434`	Malate_DH	53	67	0.069	13.7
TkA08G043730	`PF15871`	JMY	59	93	0.06	13.6
TkA08G043730	`PF05185`	PRMT5	76	150	9.2e-25	88.2
TkA08G043730	`PF12434`	Malate_DH	138	148	0.069	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWT4`	Arabidopsis thaliana	sp\|Q8GWT4\|ANM15_ARATH Protein arginine N-methyltransferase 1.5	56.000%	Swiss-Prot	High
`A2X0Q3`	Oryza sativa subsp. indica	sp\|A2X0Q3\|ANM5_ORYSI Protein arginine N-methyltransferase 5	57.100%	Swiss-Prot	High
`Q6YXZ7`	Oryza sativa subsp. japonica	sp\|Q6YXZ7\|ANM5_ORYSJ Protein arginine N-methyltransferase 5	57.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card