TkA08G033070 | RubberDandelionOmics

Gene overview

TkA08G033070

Reference: TK1151 Chr: Chr08 Coordinates: 8415787-8416692 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · TkA08G033070|TK1151|cDNA

ATGAGACCGGAGAATCTTCTCCTCCGCCCCACCCACACCCAATACTGCACTCTCGGCTGTCCGATCCTCGACGCCTTCCTCGGCGGCGGAATCCCTTGCAACTCCATCACCGAACTCGTCGCCGAAAGCGGTTCAGGTAAAACCCAACTCTCCCTCCAACTCCTCATCACCGCTCAGCTTCCTCTCCACCTCAAAGGCCTTTCCGCCTCCTCCCTCTATCTCTACTCCGAGTTCCCATTTCCCAACCGCCGTCTAGACCA...

CDS

Download CDS FASTA

906 bp · TkA08G033070|TK1151|CDS

ATGAGACCGGAGAATCTTCTCCTCCGCCCCACCCACACCCAATACTGCACTCTCGGCTGTCCGATCCTCGACGCCTTCCTCGGCGGCGGAATCCCTTGCAACTCCATCACCGAACTCGTCGCCGAAAGCGGTTCAGGTAAAACCCAACTCTCCCTCCAACTCCTCATCACCGCTCAGCTTCCTCTCCACCTCAAAGGCCTTTCCGCCTCCTCCCTCTATCTCTACTCCGAGTTCCCATTTCCCAACCGCCGTCTAGACCA...

Protein

Download Protein FASTA

301 aa · TkA08G033070|TK1151|PROTEIN

MRPENLLLRPTHTQYCTLGCPILDAFLGGGIPCNSITELVAESGSGKTQLSLQLLITAQLPLHLKGLSASSLYLYSEFPFPNRRLDQLIESFRSSHPILFASSRDPRDYIFTRNCQTAQDLLDVLLLLESRLEKPKETRLDIKLIVIDSIAALFRSDFDNNAADLMRRSSLFFKISAILKSHARRRGIAIVITNQVVDSMDDNHGSGNVRIGNLESMYTSGRRVLPALGLSWANCVNSRLFMSRHDIIEGVENGVPDSDY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G033070`
TK1151 ID	TkA08G033070
OH-1004 ID	LXL04_018024
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 95.017 / OH-1004 36.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G033070

Location Chr08:8415787-8416692 (-)

Description Similar to XRCC3: DNA repair protein XRCC3 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57450`	Plays essential roles in DNA damage repair in both somatic and meiotic cells.	The Arabidopsis homologue of Xrcc3 plays an essential role in meiosis.2004 · DOI: 10.1038/sj.emboj.7600055

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018024 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0006974 DNA damage response Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0015074 DNA integration Biological Process

GO:0031297 replication fork processing Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process

KEGG gene cross-reference

ath:AT5G57450

bta:768244

hsa:7517

mmu:74335

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.749

Rank 1 · TkA08G033070 · TK1151

Cytoplasm0.503

Rank 2 · TkA08G033070 · TK1151

Mitochondrion0.042

Rank 3 · TkA08G033070 · TK1151

Peroxisome0.029

Rank 4 · TkA08G033070 · TK1151

Lysosome / Vacuole0.016

Rank 5 · TkA08G033070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08423Rad5117-202 aa

PF23442DUF712518-50 aa

PF06745ATPase19-168 aa

PF00154RecA_N19-59 aa

PF13481AAA_2528-167 aa

PF00154RecA_N142-196 aa

PF08423Rad51265-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G033070	`PF08423`	Rad51	17	202	5.1e-27	95.4
TkA08G033070	`PF23442`	DUF7125	18	50	0.024	14.9
TkA08G033070	`PF06745`	ATPase	19	168	2.9e-06	27.6
TkA08G033070	`PF00154`	RecA_N	19	59	0.0017	18.6
TkA08G033070	`PF13481`	AAA_25	28	167	0.00011	22.6
TkA08G033070	`PF00154`	RecA_N	142	196	0.0017	18.6
TkA08G033070	`PF08423`	Rad51	265	294	5.1e-27	95.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKM5`	Arabidopsis thaliana	sp\|Q9FKM5\|XRCC3_ARATH DNA repair protein XRCC3 homolog	51.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card