TkA08G029820 | RubberDandelionOmics

Gene overview

TkA08G029820

Reference: TK1151 Chr: Chr08 Coordinates: 7623197-7626688 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2958 bp · TkA08G029820|TK1151|cDNA

TTTTAAAGGTTTTTTATTGATTTCAGCAAGTAAAGTCGGTCTCTCTACTTCTTCGTTCTTATCCTCTTCACCATACCACCACCTTCTTCCTCTTTGCGCTTAATCTACAAATCTTTTCCAATTCCCCAATTCCCATGAAACCCCCATGTTTTGTTTCTTTTCATTATTCGAATATTTATTCAAAGCTCTGTAATACCCACTTATAGCATACCATCGTTGAAGAAATCCCCATTGTTTTTCAGTCATTTCTGTAACCATTC...

CDS

Download CDS FASTA

2493 bp · TkA08G029820|TK1151|CDS

ATGTTGTCAAGATCATCGTTTAATCTGCTTAACCTAGACGATTATTCGTGCGTTGTTGATCGCGCTCGAATACCAAGAATCATGACGGTACCCGGAATTCTAACGGAGTTTGACGAAGATAACATTGCCGGCAGCGGGGAAACGGAGACGGATCAGGTATCCGATGTCGTTTCGTCTGTTACGCCTGAACGCCGGATCATTGTTTCAAATCAGTTACCGGTAAAGGCTCACCGCGACGGAGAGACGAACAAATGGGTATT...

Protein

Download Protein FASTA

830 aa · TkA08G029820|TK1151|PROTEIN

MLSRSSFNLLNLDDYSCVVDRARIPRIMTVPGILTEFDEDNIAGSGETETDQVSDVVSSVTPERRIIVSNQLPVKAHRDGETNKWVFEFDPDALVLQLKSGFGPDVECVYVGSLPVDIDSSEQEEVAQTLLDKFRCVPTFLSQEIQNKFYHGFCKHYLWPLFHYMLPVTLTHGVRFDRVAWQAYVSANKVFADKVMEVINPDEDYVWIHDYHLMVMPTFLRKRFHRVRVGFFLHSPFPSSEIYRTLPVRDEILRSLLNCD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G029820`
TK1151 ID	TkA08G029820
OH-1004 ID	LXL04_018068
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G029820

Location Chr08:7623197-7626688 (+)

Description Similar to TPS11: Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18700`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11.	No verified direct reference in this release
`At1g23870`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9.	No verified direct reference in this release
`At1g70290`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8.	No verified direct reference in this release
`At1g60140`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10.	No verified direct reference in this release
`At4g17770`	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018068 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23870

ath:AT1G60140

ath:AT1G70290

ath:AT2G18700

ath:AT4G17770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.377

Rank 1 · TkA08G029820 · TK1151

Nucleus0.256

Rank 2 · TkA08G029820 · TK1151

Cell membrane0.168

Rank 3 · TkA08G029820 · TK1151

Plastid0.122

Rank 4 · TkA08G029820 · TK1151

Golgi apparatus0.083

Rank 5 · TkA08G029820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00982Glyco_transf_2064-551 aa

PF02358Trehalose_PPase579-797 aa

PF08282Hydrolase_3695-772 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G029820	`PF00982`	Glyco_transf_20	64	551	2e-183	611.2
TkA08G029820	`PF02358`	Trehalose_PPase	579	797	1.3e-71	241.2
TkA08G029820	`PF08282`	Hydrolase_3	695	772	6.8e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV48`	Arabidopsis thaliana	sp\|Q9ZV48\|TPS11_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11	65.400%	Swiss-Prot	High
`Q9LRA7`	Arabidopsis thaliana	sp\|Q9LRA7\|TPS9_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9	59.500%	Swiss-Prot	High
`Q0WUI9`	Arabidopsis thaliana	sp\|Q0WUI9\|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8	58.900%	Swiss-Prot	High
`O80738`	Arabidopsis thaliana	sp\|O80738\|TPS10_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10	58.400%	Swiss-Prot	High
`O23617`	Arabidopsis thaliana	sp\|O23617\|TPS5_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5	57.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card