Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1635 bp · TkA08G023520|TK1151|cDNA
GAATTAATGAAGGGAAGATCATGGATAGAGTTTGGGGGTAAAGATGACATTTCAAGTAATGGGAAACCATTGATAAATGAACAAGTGTCTACAGTACATCAAATATTGAGATCATCACACTCTTCGCTATTATCTATCCATCATCGTCATCATATCAACAACATCATTTCTTCATTCATCTTTCCTTTTTTTTTTCGTTTTTCCCTTCTTCTCATTATATCTTTTCATCAATTCCATCTTCTACCCACTCAGATCGGATT...
900 bp · TkA08G023520|TK1151|CDS
ATGGGAAATGTAACCTCAAACATAGCTGCAAAATTTGCATTTTTCCCACCAGAACCGCCGTCGTATGATGTTTTCAAAGACGAAGAGGATACTCCAAATGGAGATAAAAGATATTGTATTACAGGTATAACAGCAGATAAAAACGTCGACGTTCATTTGCTTGATACAAAAGTCGGAAACAAAATCGTTGCTACCTTCTGGAAACACCCTTTTGGTAAATTCACCCTTCTCTACTCTCATGGCAACGCTGCTGATTTGGG...
Protein
Download Protein FASTA299 aa · TkA08G023520|TK1151|PROTEIN
MGNVTSNIAAKFAFFPPEPPSYDVFKDEEDTPNGDKRYCITGITADKNVDVHLLDTKVGNKIVATFWKHPFGKFTLLYSHGNAADLGQMQELFIELRAHLRLNIMSYDYSGYGASTGKPSELNTYYDIEAVYNCLKDKYGIKQEDIILYGQSVGSGPTLHLAARLQRLRGVVLHSAILSGIRVLYNVKMTFWFDIFKNIDKIQKVGCPVLVIHGTNDDIVDFSHGKRLWELAKEKYDPLWVQGGGHCNIETYPEYIRHLR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G023520 |
|---|---|
| TK1151 ID | TkA08G023520 |
| OH-1004 ID | LXL04_018152 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G023520 |
|---|---|
| Location | Chr08:5975365-5978175 (+) |
| Description | Similar to abhd17c: Alpha/beta hydrolase domain-containing protein 17C |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002084 protein depalmitoylation Biological Process GO:1902473 regulation of protein localization to synapse Biological Process GO:1902817 negative regulation of protein localization to microtubule Biological Process GO:1905668 positive regulation of protein localization to endosome Biological Process GO:0005886 plasma membrane Cellular Component GO:0010008 endosome membrane Cellular Component GO:0016020 membrane Cellular Component GO:0055038 recycling endosome membrane Cellular Component GO:0008474 palmitoyl-(protein) hydrolase activity Molecular Function |
| KEGG gene cross-reference | dre:393126 gga:415479 gga:427252 hsa:51104 rno:309399 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12146Hydrolase_475-179 aaPF20408Abhydrolase_1175-246 aaPF00561Abhydrolase_176-176 aaPF05677DUF81876-155 aaPF12697Abhydrolase_692-176 aaPF03583LIP104-166 aaPF02129Peptidase_S15108-182 aaPF00326Peptidase_S9123-234 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G023520 | PF12146 | Hydrolase_4 | 75 | 179 | 7.6e-12 | 45.8 |
| TkA08G023520 | PF20408 | Abhydrolase_11 | 75 | 246 | 0.057 | 13.9 |
| TkA08G023520 | PF00561 | Abhydrolase_1 | 76 | 176 | 6e-11 | 43.2 |
| TkA08G023520 | PF05677 | DUF818 | 76 | 155 | 0.00096 | 19.0 |
| TkA08G023520 | PF12697 | Abhydrolase_6 | 92 | 176 | 1.3e-06 | 29.9 |
| TkA08G023520 | PF03583 | LIP | 104 | 166 | 0.11 | 12.5 |
| TkA08G023520 | PF02129 | Peptidase_S15 | 108 | 182 | 0.012 | 16.1 |
| TkA08G023520 | PF00326 | Peptidase_S9 | 123 | 234 | 9.1e-05 | 22.8 |
| TkA08G023520 | PF07859 | Abhydrolase_3 | 124 | 175 | 0.039 | 14.4 |
| TkA08G023520 | PF01738 | DLH | 127 | 232 | 0.018 | 15.3 |
| TkA08G023520 | PF08840 | BAAT_C | 131 | 188 | 0.073 | 13.8 |
| TkA08G023520 | PF20434 | BD-FAE | 137 | 155 | 0.0033 | 17.7 |
| TkA08G023520 | PF02230 | Abhydrolase_2 | 138 | 234 | 0.00011 | 22.9 |
| TkA08G023520 | PF06821 | Ser_hydrolase | 140 | 250 | 0.15 | 12.6 |
| TkA08G023520 | PF12695 | Abhydrolase_5 | 142 | 174 | 0.045 | 14.2 |
| TkA08G023520 | PF03959 | FSH1 | 171 | 246 | 0.0059 | 17.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.