TkA07G433430 | RubberDandelionOmics

Gene overview

TkA07G433430

Reference: TK1151 Chr: Chr07 Coordinates: 109660934-109663729 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2295 bp · TkA07G433430|TK1151|cDNA

ATGGGTTCTGCAGATGAAGCTTACAACGATCCATTTGTGGGAATTTATGAGCCGTTTGAAGGGATTAATGAGATGGATTTCGAGCTCCATGGTATATTTATGGACCACGAACCAGAGCAGGAGTTCTTGACAAGTCTTGATAAATGTAAGGATGGCGTAACCCGTTCCCTTAATGGCGCCCCCAGCAGGTCACCACTTTGGTCGCTCACGAAGAGCAACCCACCGATCCTTAGGAAACCCCCGGACAACTGGGGTAAAAC...

CDS

Download CDS FASTA

2295 bp · TkA07G433430|TK1151|CDS

ATGGGTTCTGCAGATGAAGCTTACAACGATCCATTTGTGGGAATTTATGAGCCGTTTGAAGGGATTAATGAGATGGATTTCGAGCTCCATGGTATATTTATGGACCACGAACCAGAGCAGGAGTTCTTGACAAGTCTTGATAAATGTAAGGATGGCGTAACCCGTTCCCTTAATGGCGCCCCCAGCAGGTCACCACTTTGGTCGCTCACGAAGAGCAACCCACCGATCCTTAGGAAACCCCCGGACAACTGGGGTAAAAC...

Protein

Download Protein FASTA

764 aa · TkA07G433430|TK1151|PROTEIN

MGSADEAYNDPFVGIYEPFEGINEMDFELHGIFMDHEPEQEFLTSLDKCKDGVTRSLNGAPSRSPLWSLTKSNPPILRKPPDNWGKTRMPPPWFEHPTSQRRPSALTNRSGAHWLNVLLSNANLRNASMSDEVSAQVYHANEWKSDEEAEEEVKNNYRIHDLNVRWDLMEPKVGDVFESPTQLKYCVTNYAVSGGYEIYFEKSDTKRIVARCGKKKADKKCPYRLYAAWMYNERTFQDYADELLRSNPGSTYKLGVTSNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G433430`
TK1151 ID	TkA07G433430
OH-1004 ID	LXL04_007719
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.500
Protein coverage (%)	TK1151 70.419 / OH-1004 28.832 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G433430`
Location	Chr07:109660934-109663729 (+)
Description	Similar to MAN5: Mannan endo-1,4-beta-mannosidase 5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007719` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000272 polysaccharide catabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0016985 mannan endo-1,4-beta-mannosidase activity Molecular Function
KEGG gene cross-reference	dosa:Os01g0663300 sly:544170 sly:544199 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928

Rank 1 · TkA07G433430 · TK1151

Cytoplasm0.143

Rank 2 · TkA07G433430 · TK1151

Cell membrane0.025

Rank 3 · TkA07G433430 · TK1151

Mitochondrion0.020

Rank 4 · TkA07G433430 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA07G433430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00805Pentapeptide110-130 aa

PF28079GvpQ-like147-154 aa

PF03108DBD_Tnp_Mut172-236 aa

PF10551MULE306-402 aa

PF00872Transposase_mut324-405 aa

PF10551MULE465-502 aa

PF03108DBD_Tnp_Mut510-528 aa

PF28079GvpQ-like641-689 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G433430	`PF00805`	Pentapeptide	110	130	0.24	11.7
TkA07G433430	`PF28079`	GvpQ-like	147	154	4.3	8.2
TkA07G433430	`PF03108`	DBD_Tnp_Mut	172	236	9.9e-08	32.2
TkA07G433430	`PF10551`	MULE	306	402	1.6e-18	67.6
TkA07G433430	`PF00872`	Transposase_mut	324	405	5e-08	32.9
TkA07G433430	`PF10551`	MULE	465	502	1.6e-18	67.6
TkA07G433430	`PF03108`	DBD_Tnp_Mut	510	528	9.9e-08	32.2
TkA07G433430	`PF28079`	GvpQ-like	641	689	4.3	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card