Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1613 bp · TkA07G394800|TK1151|cDNA
AACACCTTTAACCTAACTCCCCTTTTATTATTTTCCATATTAAACTCCATAAATATTACAAAATCCATTCAACTTTTTCCTGCAACCCAAAAACATGGCATCTCAAACCCATGTCAATGTCCACTCACGTCTCACCGTTGTGTCTAGCACCCCTACTGAGCCAATGGGTTCGACCAATGGTCTAACCCCAATCGACCACACCATGGGCTCACACACGGTTCATATTATATTCTACTATCGAACCAGCCCTTTTGCTAAAA...
1419 bp · TkA07G394800|TK1151|CDS
ATGGCATCTCAAACCCATGTCAATGTCCACTCACGTCTCACCGTTGTGTCTAGCACCCCTACTGAGCCAATGGGTTCGACCAATGGTCTAACCCCAATCGACCACACCATGGGCTCACACACGGTTCATATTATATTCTACTATCGAACCAGCCCTTTTGCTAAAAAAGGTCGGTTCGCTTTGGACTTGGATAATGTCCGGGTTTCACTTTCGGACCTTTTATCCAAGTATCCACGGATGACGGGTCGGTTGTTTCGTGA...
Protein
Download Protein FASTA472 aa · TkA07G394800|TK1151|PROTEIN
MASQTHVNVHSRLTVVSSTPTEPMGSTNGLTPIDHTMGSHTVHIIFYYRTSPFAKKGRFALDLDNVRVSLSDLLSKYPRMTGRLFRDDDGNWGVRYNDAGVRMFKADVGITVDEWLKTADESDERNLTMWEDMPDGDPTSWSPFQIQVSEFLEGGLSIGLSFTHLLADPTSGTLFYKSWTDAERGDPTGHRTPIFSLPQLDNRPPPAATGTTCTTTEYLQKNSKLAPISSEKMATSVFKFSNSTIKQCLSKISDRCPDAN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G394800 |
|---|---|
| TK1151 ID | TkA07G394800 |
| OH-1004 ID | LXL04_030292 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G394800 |
|---|---|
| Location | Chr07:99175329-99178947 (-) |
| Description | Similar to CER2: Protein ECERIFERUM 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009555 pollen development Biological Process GO:0010025 wax biosynthetic process Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function GO:0050734 hydroxycinnamoyltransferase activity Molecular Function |
| KEGG gene cross-reference | ath:AT3G23840 ath:AT4G24510 dosa:Os02g0611800 dosa:Os04g0500700 osa:4336306 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02458Transferase6-455 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G394800 | PF02458 | Transferase | 6 | 455 | 4.9e-40 | 138.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.