TkA07G384210 | RubberDandelionOmics

Gene overview

TkA07G384210

Reference: TK1151 Chr: Chr07 Coordinates: 96351489-96355034 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · TkA07G384210|TK1151|cDNA

ATGCAAGTGATTGTCTGGCTGAATGGCAAAGGCCCTGACTTCCCTATGGGAGGTCATGGGTTCGAGTCCTTCTCCAGGCATGATGCATCCAGGGTTTTACCCAGTTGTGGGGTTTCCCAGGAAAAGGTGGGTTCGAGCCTCGGCAAGAACCAAAGTGGTGAAATTAAGGAGGGGGGAAAGGGCGGCGATTCCAGGCTGCCCGGCAAGTCCGGACCTGTGTCTAACGTTCCCGAAAGTCGGGGTCCTCTGACTGTTGGCCT...

CDS

Download CDS FASTA

1209 bp · TkA07G384210|TK1151|CDS

ATGCAAGTGATTGTCTGGCTGAATGGCAAAGGCCCTGACTTCCCTATGGGAGGTCATGGGTTCGAGTCCTTCTCCAGGCATGATGCATCCAGGGTTTTACCCAGTTGTGGGGTTTCCCAGGAAAAGGTGGGTTCGAGCCTCGGCAAGAACCAAAGTGGTGAAATTAAGGAGGGGGGAAAGGGCGGCGATTCCAGGCTGCCCGGCAAGTCCGGACCTGTGTCTAACGTTCCCGAAAGTCGGGGTCCTCTGACTGTTGGCCT...

Protein

Download Protein FASTA

402 aa · TkA07G384210|TK1151|PROTEIN

MQVIVWLNGKGPDFPMGGHGFESFSRHDASRVLPSCGVSQEKVGSSLGKNQSGEIKEGGKGGDSRLPGKSGPVSNVPESRGPLTVGLDGFLYETLSPLATNVAVSTPASTPPPAPDLPSDSEPYLVLRNHIPISTNSTPLPETSAPEFFSLDVDADDWRTPTPPLKRSRLAPALPDEEPKRSLEAGWFRANCRFKSPMLQLHKEILDFCDFLSPTPEEAVSRNTAVESVSDVIKYIWPTCKVEVFGSFKTGLFLPSSDVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G384210`
TK1151 ID	TkA07G384210
OH-1004 ID	LXL04_001985
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 76.866 / OH-1004 60.234 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G384210`
Location	Chr07:96351489-96355034 (-)
Description	Similar to TENT4B: Terminal nucleotidyltransferase 4B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001985` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006302 double-strand break repair Biological Process GO:0006364 rRNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0006401 RNA catabolic process Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007076 mitotic chromosome condensation Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0010587 miRNA catabolic process Biological Process GO:0031123 RNA 3'-end processing Biological Process GO:0031124 mRNA 3'-end processing Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0033500 carbohydrate homeostasis Biological Process
KEGG gene cross-reference	dme:Dmel_CG11265 hsa:11044 hsa:64282 mmu:210106 mmu:214627 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.752

Rank 1 · TkA07G384210 · TK1151

Cytoplasm0.266

Rank 2 · TkA07G384210 · TK1151

Cell membrane0.040

Rank 3 · TkA07G384210 · TK1151

Endoplasmic reticulum0.034

Rank 4 · TkA07G384210 · TK1151

Mitochondrion0.028

Rank 5 · TkA07G384210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22600MTPAP-like_central201-324 aa

PF19088TUTase217-316 aa

PF14792DNA_pol_B_palm226-271 aa

PF01909NTP_transf_2229-325 aa

PF20750PAP_NTPase240-317 aa

PF18765Polbeta242-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G384210	`PF22600`	MTPAP-like_central	201	324	6e-25	88.7
TkA07G384210	`PF19088`	TUTase	217	316	0.00014	22.3
TkA07G384210	`PF14792`	DNA_pol_B_palm	226	271	0.17	12.8
TkA07G384210	`PF01909`	NTP_transf_2	229	325	3.8e-07	31.1
TkA07G384210	`PF20750`	PAP_NTPase	240	317	0.00019	22.1
TkA07G384210	`PF18765`	Polbeta	242	267	0.091	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card