TkA07G383060 | RubberDandelionOmics

Gene overview

TkA07G383060

Reference: TK1151 Chr: Chr07 Coordinates: 96065972-96068828 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1324 bp · TkA07G383060|TK1151|cDNA

GCAAGTGTAAGAGGTGGCTGGTGGGTGGCGCAGGGCGATGGCGACGGCGACGGTCAGGGTGGAAGATTTGCACCATTTTCAGTATCTTCTAATAATCCGTATATCATGGAGGGAGTACGCCGGGAAGAACTTGCACCGCCGACCATCGCCTCAAAAGTAAGCCCGTCGGCGAAGAAGGCACTGTTAATTCTCAACTGCGTTCTCTTGTCGCTCGGAAACTGTGGTGGCCCATTGAGCATGCGCCTCTATTTCATCCACGG...

CDS

Download CDS FASTA

1200 bp · TkA07G383060|TK1151|CDS

GCAAGTGTAAGAGGTGGCTGGTGGGTGGCGCAGGGCGATGGCGACGGCGACGGTCAGGGTGGAAGATTTGCACCATTTTCAGTATCTTCTAATAATCCGTATATCATGGAGGGAGTACGCCGGGAAGAACTTGCACCGCCGACCATCGCCTCAAAAGTAAGCCCGTCGGCGAAGAAGGCACTGTTAATTCTCAACTGCGTTCTCTTGTCGCTCGGAAACTGTGGTGGCCCATTGAGCATGCGCCTCTATTTCATCCACGG...

Protein

Download Protein FASTA

399 aa · TkA07G383060|TK1151|PROTEIN

ASVRGGWWVAQGDGDGDGQGGRFAPFSVSSNNPYIMEGVRREELAPPTIASKVSPSAKKALLILNCVLLSLGNCGGPLSMRLYFIHGGNRVWLSAFLETGGWPFTLIVLIVLYFHRRCSTLVYMRPRVFLAAAVIGVLTGVDDFLYACGVSRLPVSTTSLIIASQLGFTAFFAFLLVKQKFTPYSINAVMLLTIGAAVLALHTSSDLPNGESRAEYLKGFFMTVAAAALYGLVLPMVEMTYNKAKQAITYTLVLEIQTVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G383060`
TK1151 ID	TkA07G383060
OH-1004 ID	LXL04_030162
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 98.246 / OH-1004 96.790 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G383060

Location Chr07:96065972-96068828 (-)

Description Similar to PUP3: Purine permease 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28220`	May be involved in transport of purine derivatives during pollen germination and tube elongation.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At1g28230`	Proton-coupled purine transporter mediating adenine and trans-zeatin uptake.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x Recycling of pyridoxine (vitamin B6) by PUP1 in Arabidopsis.2013 · DOI: 10.1111/tpj.12195
`At2g33750`	Mediates adenine transport.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At4g18220`	Purine permease 21.	No verified direct reference in this release
`At4g18210`	Probable purine permease 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030162 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006863 purine nucleobase transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005345 purine nucleobase transmembrane transporter activity Molecular Function

GO:0015211 purine nucleoside transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G28220

ath:AT1G28230

ath:AT2G33750

ath:AT4G18210

ath:AT4G18220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.471

Rank 1 · TkA07G383060 · TK1151

Lysosome / Vacuole0.219

Rank 2 · TkA07G383060 · TK1151

Endoplasmic reticulum0.164

Rank 3 · TkA07G383060 · TK1151

Golgi apparatus0.112

Rank 4 · TkA07G383060 · TK1151

Cytoplasm0.106

Rank 5 · TkA07G383060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16913PUNUT61-376 aa

PF00892EamA104-199 aa

PF04142Nuc_sug_transp132-248 aa

PF20794bPH_7163-163 aa

PF00892EamA218-363 aa

PF04142Nuc_sug_transp254-363 aa

PF20794bPH_7309-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G383060	`PF16913`	PUNUT	61	376	3.4e-109	365.7
TkA07G383060	`PF00892`	EamA	104	199	8.6e-07	30.0
TkA07G383060	`PF04142`	Nuc_sug_transp	132	248	0.056	13.3
TkA07G383060	`PF20794`	bPH_7	163	163	8.3	6.8
TkA07G383060	`PF00892`	EamA	218	363	8.6e-07	30.0
TkA07G383060	`PF04142`	Nuc_sug_transp	254	363	0.056	13.3
TkA07G383060	`PF20794`	bPH_7	309	381	8.3	6.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ95`	Arabidopsis thaliana	sp\|Q9FZ95\|PUP3_ARATH Purine permease 3	57.900%	Swiss-Prot	High
`Q9FZ96`	Arabidopsis thaliana	sp\|Q9FZ96\|PUP1_ARATH Purine permease 1	55.500%	Swiss-Prot	High
`Q94GB1`	Arabidopsis thaliana	sp\|Q94GB1\|PUP2_ARATH Purine permease 2	50.000%	Swiss-Prot	High
`O49726`	Arabidopsis thaliana	sp\|O49726\|PUP21_ARATH Purine permease 21	35.100%	Swiss-Prot	Medium
`O49725`	Arabidopsis thaliana	sp\|O49725\|PUP10_ARATH Probable purine permease 10	34.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card