TkA07G357540 | RubberDandelionOmics

Gene overview

TkA07G357540

Reference: TK1151 Chr: Chr07 Coordinates: 89566319-89569577 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2724 bp · TkA07G357540|TK1151|cDNA

GGGTGATGTTTTATCATTATTATTATCATTATTATAAAACATCGTCTTATTCATGGGTAAATCTAGACCTCCATACTCCAAATTATGTAAAGAATCAAATGTGAAGCTCACTACACCTCCAATGGCAGCCACCTTCATCTTACACCTCTTCTTCCTCATACAATCTCTCCAAATCCACTATTCTGATTCTCAATCTCTCCAATCTCTACAAACTCTATTTACCACTTTCAATGCAAGAGGTACAAGTAATTACTGCCCGA...

CDS

Download CDS FASTA

465 bp · TkA07G357540|TK1151|CDS

ATGCTCACTGATGCACGATACATTTCGGAGACAATGAAGTTAGGAGGAGTTGGAATTCTGTATCGAACTTATGTTTTAGGGGAGTTGATTGAAGCCACAAATAACTTCCATAAATCGACGTTCATGGCAATGTTTTATATGTGCAATCAGCTTTACAAAGGGCACCTTAATGATGGAAGTATAGTTGCGATTAGAAACTTGAACTTGAGAAAGAAGTCTAGTATCCAGAGCTGTACCAGACAGATTGAGCTCATTTCTAA...

Protein

Download Protein FASTA

154 aa · TkA07G357540|TK1151|PROTEIN

MLTDARYISETMKLGGVGILYRTYVLGELIEATNNFHKSTFMAMFYMCNQLYKGHLNDGSIVAIRNLNLRKKSSIQSCTRQIELISKLRHPNLVNPIGHCFDRHPDDSAIIPRVFLVFEFVPNGTLRASLTVGQKFSWAQRLSLLSGFQKGFSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G357540`
TK1151 ID	TkA07G357540
OH-1004 ID	LXL04_011496
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	40.900
Protein coverage (%)	TK1151 94.156 / OH-1004 20.699 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G357540

Location Chr07:89566319-89569577 (+)

Description Similar to At1g14390: Probable LRR receptor-like serine/threonine-protein kinase At1g14390

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03770`	Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770.	No verified direct reference in this release
`At1g24030`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g66790`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g49730`	Probable receptor-like protein kinase At1g49730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005496 steroid binding Molecular Function

KEGG gene cross-reference

ath:AT1G14390

ath:AT2G02780

ath:AT3G03770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.480

Rank 1 · TkA07G357540 · TK1151

Cytoplasm0.357

Rank 2 · TkA07G357540 · TK1151

Nucleus0.268

Rank 3 · TkA07G357540 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA07G357540 · TK1151

Plastid0.025

Rank 5 · TkA07G357540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr52-151 aa

PF00069Pkinase55-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G357540	`PF07714`	PK_Tyr_Ser-Thr	52	151	2.3e-07	31.1
TkA07G357540	`PF00069`	Pkinase	55	138	5.4e-05	23.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFN2`	Arabidopsis thaliana	sp\|Q8LFN2\|Y3037_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770	50.600%	Swiss-Prot	High
`Q84M95`	Arabidopsis thaliana	sp\|Q84M95\|PBL28_ARATH Probable serine/threonine-protein kinase PBL28	32.100%	Swiss-Prot	Medium
`Q8GYF5`	Arabidopsis thaliana	sp\|Q8GYF5\|WAKLR_ARATH Wall-associated receptor kinase-like 21	35.200%	Swiss-Prot	Medium
`Q9CAL8`	Arabidopsis thaliana	sp\|Q9CAL8\|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13	31.000%	Swiss-Prot	Medium
`Q9FX99`	Arabidopsis thaliana	sp\|Q9FX99\|Y1497_ARATH Probable receptor-like protein kinase At1g49730	30.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card