TkA07G236830 | RubberDandelionOmics

Gene overview

TkA07G236830

Reference: TK1151 Chr: Chr07 Coordinates: 59279508-59280327 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA07G236830|TK1151|cDNA

AAACTGATCAGTACGATGTGGGGTACCGACTTTATGGACAGTAACGACGTGTCCTTACGGTATGATTATGGGAAATTTTATGCTTCAAAATCATTTTACGATGGTGAGAAGAAGAGAAGGATATTATGGTCATGGATTAGTGAGGGTGATGGTGATTCAAATGATATCAAGAAAGGGTGGTCTGGACTTCAGTCAATTCCTAGGAGCATCTGGCTGAGTAAAAACGGAAAGCAGTTGGTGCAGTGGCCAATCAAGGAACT...

CDS

Download CDS FASTA

576 bp · TkA07G236830|TK1151|CDS

ATGTGGGGTACCGACTTTATGGACAGTAACGACGTGTCCTTACGGTATGATTATGGGAAATTTTATGCTTCAAAATCATTTTACGATGGTGAGAAGAAGAGAAGGATATTATGGTCATGGATTAGTGAGGGTGATGGTGATTCAAATGATATCAAGAAAGGGTGGTCTGGACTTCAGTCAATTCCTAGGAGCATCTGGCTGAGTAAAAACGGAAAGCAGTTGGTGCAGTGGCCAATCAAGGAACTAGAAAAGCTACGTAC...

Protein

Download Protein FASTA

192 aa · TkA07G236830|TK1151|PROTEIN

MWGTDFMDSNDVSLRYDYGKFYASKSFYDGEKKRRILWSWISEGDGDSNDIKKGWSGLQSIPRSIWLSKNGKQLVQWPIKELEKLRTKKVHYVNKELRGGSMLEISGITASQADIEVTFSLLNLSEADLLKEVVDPQLLCTKYNVSVSGSLGPFGLLILASKDLREYTAVFFRVFTVNNSFYLLMCADQSRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G236830`
TK1151 ID	TkA07G236830
OH-1004 ID	LXL04_028831
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.900
Protein coverage (%)	TK1151 98.438 / OH-1004 33.275 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G236830

Location Chr07:59279508-59280327 (-)

Description Similar to CWINV1: Beta-fructofuranosidase, insoluble isoenzyme CWINV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13790`	Beta-fructofuranosidase that can use sucrose and 1-kestose, and, to a lower extent, neokestose and levan, as substrates, but not inuline.	Unraveling the difference between invertases and fructan exohydrolases: a single amino acid (Asp-239) substitution transforms Arabidopsis cell wall invertase1 into a fructan 1-exohydrolase.2007 · DOI: 10.1104/pp.107.105049
`At1g55120`	6-fructan exohydrolase that can use phlein, levan, neokestose, levanbiose, 6-kestose, and 1-kestose as substrates.	No verified direct reference in this release
`At3g13784`	Beta-fructofuranosidase, insoluble isoenzyme CWINV5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028831 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004564 beta-fructofuranosidase activity Molecular Function

GO:0033949 fructan beta-(2,6)-fructosidase activity Molecular Function

KEGG gene cross-reference

ag:CAD48404

ath:AT1G55120

ath:AT3G13784

ath:AT3G13790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.566

Rank 1 · TkA07G236830 · TK1151

Lysosome / Vacuole0.119

Rank 2 · TkA07G236830 · TK1151

Cytoplasm0.100

Rank 3 · TkA07G236830 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA07G236830 · TK1151

Cell membrane0.040

Rank 5 · TkA07G236830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00251Glyco_hydro_32N11-78 aa

PF08244Glyco_hydro_32C81-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G236830	`PF00251`	Glyco_hydro_32N	11	78	6.8e-19	69.3
TkA07G236830	`PF08244`	Glyco_hydro_32C	81	176	3.2e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43866`	Arabidopsis thaliana	sp\|Q43866\|INV1_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV1	56.000%	Swiss-Prot	High
`Q67XZ3`	Arabidopsis thaliana	sp\|Q67XZ3\|INV3_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV3	51.300%	Swiss-Prot	High
`Q9LIB9`	Arabidopsis thaliana	sp\|Q9LIB9\|INV5_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV5	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card