TkA07G198400 | RubberDandelionOmics

Gene overview

TkA07G198400

Reference: TK1151 Chr: Chr07 Coordinates: 50112900-50113614 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

513 bp · TkA07G198400|TK1151|cDNA

ATGGGTTTCGGTAGTAATCTTGGGTTAGCACTTTTCCTACTATCGCTGTTTTGGGAAGGTACGATGTCACAATCAGGGTGCACAAATACGCTCATTGGAATGGCTCCATGCCTAAACTATGTTACTGGAAATTCCAAAACACCGTCTTCTTCTTGTTGTTCGTCTCTGGAAAATGTTGTTACATCACAACCACAGTGCCTTTGCACAGCCCTTGATGGCAGCACTATGGCGGCACTAGGAATCAATATCAATAAAACTAT...

CDS

Download CDS FASTA

513 bp · TkA07G198400|TK1151|CDS

ATGGGTTTCGGTAGTAATCTTGGGTTAGCACTTTTCCTACTATCGCTGTTTTGGGAAGGTACGATGTCACAATCAGGGTGCACAAATACGCTCATTGGAATGGCTCCATGCCTAAACTATGTTACTGGAAATTCCAAAACACCGTCTTCTTCTTGTTGTTCGTCTCTGGAAAATGTTGTTACATCACAACCACAGTGCCTTTGCACAGCCCTTGATGGCAGCACTATGGCGGCACTAGGAATCAATATCAATAAAACTAT...

Protein

Download Protein FASTA

170 aa · TkA07G198400|TK1151|PROTEIN

MGFGSNLGLALFLLSLFWEGTMSQSGCTNTLIGMAPCLNYVTGNSKTPSSSCCSSLENVVTSQPQCLCTALDGSTMAALGININKTIALALPGACHVNTPPVTRCGGGNNAPMLAPVSSPENSDGLSPTSIFLAGSKHILSNGQTSNIAFERKDMHKLLSGILVLVALFP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G198400`
TK1151 ID	TkA07G198400
OH-1004 ID	LXL04_028726
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G198400

Location Chr07:50112900-50113614 (+)

Description Similar to YLS3: Protein YLS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22600`	Lipid transfer protein involved in seed and ovule maturation and development, probably by regulating the fatty acids homeostasis during suberin and sporopollenin biosynthesis or deposition.	Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740
`At2g48130`	Probable lipid transfer protein.	No verified direct reference in this release
`At4g14815`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g44300`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g44290`	Probable lipid transfer protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028726 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0006508 proteolysis Biological Process

GO:0006869 lipid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0009625 response to insect Biological Process

GO:0009845 seed germination Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010214 seed coat development Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080027 response to herbivore Biological Process

KEGG gene cross-reference

ath:AT1G03103

ath:AT2G44300

ath:AT2G48130

ath:AT3G22600

ath:AT4G14815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.726

Rank 1 · TkA07G198400 · TK1151

Endoplasmic reticulum0.101

Rank 2 · TkA07G198400 · TK1151

Extracellular0.095

Rank 3 · TkA07G198400 · TK1151

Cytoplasm0.084

Rank 4 · TkA07G198400 · TK1151

Lysosome / Vacuole0.044

Rank 5 · TkA07G198400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368LTP_223-105 aa

PF00234Tryp_alpha_amyl27-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G198400	`PF14368`	LTP_2	23	105	1e-17	64.8
TkA07G198400	`PF00234`	Tryp_alpha_amyl	27	105	2.4e-14	54.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJ86`	Arabidopsis thaliana	sp\|Q9LJ86\|LTPG5_ARATH Non-specific lipid transfer protein GPI-anchored 5	52.000%	Swiss-Prot	Medium
`Q7EB72`	Arabidopsis thaliana	sp\|Q7EB72\|LTG15_ARATH Non-specific lipid transfer protein GPI-anchored 15	39.600%	Swiss-Prot	Medium
`Q2PE59`	Arabidopsis thaliana	sp\|Q2PE59\|LTG26_ARATH Non-specific lipid transfer protein GPI-anchored 26	54.500%	Swiss-Prot	Medium
`O64865`	Arabidopsis thaliana	sp\|O64865\|LTG14_ARATH Non-specific lipid transfer protein GPI-anchored 14	42.500%	Swiss-Prot	Medium
`O64864`	Arabidopsis thaliana	sp\|O64864\|LTG13_ARATH Non-specific lipid transfer protein GPI-anchored 13	37.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card