Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2988 bp · TkA07G129540|TK1151|cDNA
TTTGAAAATGATGGTTATAAGAAACATTCTCTCAAACCAAGAGGGTTATAAATGAAATTTGAAATTAACTTTGGAAATCAGTGGGCGCTTGAAAGTGTCAAAGCAGCCGGAAGTCCGAAACTATGGGGTTATAATTAGGGTTTTTATAAGAAAAGTCGCTCAGTTTTTGGTCAGTTAACGATTAAGTCCCTAACTTTTGTTTATTAGCAATCTTGAAATTGGAGTAATTGATGGCTGGCTCATATAAAACTTGAACTGCA...
2457 bp · TkA07G129540|TK1151|CDS
ATGGCAACCTCATCAACCCCAACTCCTCCTTATATTTCATCACAAATACAAGACCTTAACTACCTGTACGCATCAATCGCCAACGTCTCCAACTTCGTTTCTGTAAAGCTTGCCAGTGACCGCAACTACCATCTTTGGAAGACCCAGATGCTTTGTCTCATGAAGACTCACAACATGGTTGGCCTCGTAGATGACACAATCGTGGGTCCCACAGCTTCAACCAATGAGATTATGGATCAATACGACAGCCTTCTTAAAGG...
Protein
Download Protein FASTA818 aa · TkA07G129540|TK1151|PROTEIN
MATSSTPTPPYISSQIQDLNYLYASIANVSNFVSVKLASDRNYHLWKTQMLCLMKTHNMVGLVDDTIVGPTASTNEIMDQYDSLLKGWIFGSVTENVLAAVVDLLSAKDVWDNLKSFYDAPITSLNADRGGTKQEAKSETKDIDGITAEAKPDVKDTITIDVNETETKTQGLDKEKLEELLGHTLKGNFYRAKSILRKNKDTARVAIRDDGSTILHLAVALGHNDFVKELVSYIKDEDYVLERRSSDGSTALHIAAIVGN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G129540 |
|---|---|
| TK1151 ID | TkA07G129540 |
| OH-1004 ID | LXL04_028202 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 95.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 99.755Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G129540 |
|---|---|
| Location | Chr07:33484111-33492170 (-) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0006654 phosphatidic acid biosynthetic process Biological Process GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway Biological Process GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0046339 diacylglycerol metabolic process Biological Process GO:0046486 glycerolipid metabolic process Biological Process GO:0046580 negative regulation of Ras protein signal transduction Biological Process GO:0046834 lipid phosphorylation Biological Process GO:0050860 negative regulation of T cell receptor signaling pathway Biological Process GO:0070682 proteasome regulatory particle assembly Biological Process GO:0099562 maintenance of postsynaptic density structure Biological Process |
| KEGG gene cross-reference | ath:AT5G02620 ddi:DDB_G0287345 rno:81821 spo:2542919 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17241Retrotran_gag_427-105 aaPF14244Retrotran_gag_332-70 aaPF14223Retrotran_gag_253-120 aaPF13637Ank_4188-226 aaPF12796Ank_2193-273 aaPF13857Ank_5202-255 aaPF00023Ank210-231 aaPF13606Ank_3210-234 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G129540 | PF17241 | Retrotran_gag_4 | 27 | 105 | 0.032 | 14.7 |
| TkA07G129540 | PF14244 | Retrotran_gag_3 | 32 | 70 | 0.0029 | 18.1 |
| TkA07G129540 | PF14223 | Retrotran_gag_2 | 53 | 120 | 4.6e-06 | 27.2 |
| TkA07G129540 | PF13637 | Ank_4 | 188 | 226 | 5.4e-05 | 24.1 |
| TkA07G129540 | PF12796 | Ank_2 | 193 | 273 | 3.5e-21 | 76.3 |
| TkA07G129540 | PF13857 | Ank_5 | 202 | 255 | 0.00021 | 22.3 |
| TkA07G129540 | PF00023 | Ank | 210 | 231 | 1.1e-10 | 41.9 |
| TkA07G129540 | PF13606 | Ank_3 | 210 | 234 | 1.6e-06 | 28.6 |
| TkA07G129540 | PF12796 | Ank_2 | 215 | 306 | 3.5e-21 | 76.3 |
| TkA07G129540 | PF13637 | Ank_4 | 215 | 267 | 5.4e-05 | 24.1 |
| TkA07G129540 | PF13857 | Ank_5 | 244 | 289 | 0.00021 | 22.3 |
| TkA07G129540 | PF00023 | Ank | 247 | 271 | 1.1e-10 | 41.9 |
| TkA07G129540 | PF13606 | Ank_3 | 247 | 270 | 1.6e-06 | 28.6 |
| TkA07G129540 | PF13637 | Ank_4 | 252 | 301 | 5.4e-05 | 24.1 |
| TkA07G129540 | PF00023 | Ank | 282 | 302 | 1.1e-10 | 41.9 |
| TkA07G129540 | PF13606 | Ank_3 | 282 | 303 | 1.6e-06 | 28.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.