RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G058850
Reference: TK1151 Chr: Chr07 Coordinates: 15591005-15616449 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3935 bp · TkA07G058850|TK1151|cDNA

TGCTTGATAGAAAAATGGGAAAACATGGGTTTGTTTGGGGGCTGGTGATCACGAGAGGAATGAGGGAAGAGGTGATGTGGTTTTTCATTTTTAAATATATAAAACACAAAGGAAAGAGGGTGGGAGAACGATGTGGTTTGAAATGTAATGGTTATGGTTAGCTTTAGAGGTACTACTTAGGGGCTGTTTGTTTGGCAGGAAAGGAATGAAATTGGAAGGAAAAGGATTCCAATTCCATCCAATTCCTGCGTTTGGTTCAA...

CDS

Download CDS FASTA

1683 bp · TkA07G058850|TK1151|CDS

ATGGACGACAACGTTGATCAAAACGCCCGATACATAGAAACTTTGCAAGGGAACACAAGCTTACCGCCACTGTATACAACCGCACGTCTCTCACCAATAACACTCACTTACTTTAGCTATTGTTTGGAAAACGGGGAATACGCTGTTAATTTGCACTTTGCAGAGATCATGTTCACCAACGATACTACATTTAGAAGCCTCGGTCGTCGGGTGTTTGATATTTATATCCAGGGGCGACGTGTTAGGAGAAATTTTAATAT...

Protein

Download Protein FASTA

560 aa · TkA07G058850|TK1151|PROTEIN

MDDNVDQNARYIETLQGNTSLPPLYTTARLSPITLTYFSYCLENGEYAVNLHFAEIMFTNDTTFRSLGRRVFDIYIQGRRVRRNFNIQDEAGGVGRPLVLPFNASVTDNILEIRFYWAGKGTTRFPRRGVYGPLVSAIDVDPYFKTCSIGGKNSNKAVFIGVGVAVPCFVLLILVILWWKNCFKKRRTNDKDFEGMSFSTISFSLRQLKLATDNFNDSNKIGEGGFGPVYKGTLSDGTVIAVKQLSAQSRQGNREFLNEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G058850
TK1151 IDTkA07G058850
OH-1004 IDLXL04_027435
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)86.800
Protein coverage (%)TK1151 100.000 / OH-1004 54.829
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G058850
LocationChr07:15591005-15616449 (+)
DescriptionSimilar to RKF1: Probable LRR receptor-like serine/threonine-protein kinase RFK1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g29750 Probable LRR receptor-like serine/threonine-protein kinase RFK1. No verified direct reference in this release
At1g07650 Probable LRR receptor-like serine/threonine-protein kinase At1g07650. No verified direct reference in this release
At1g53430 Probable LRR receptor-like serine/threonine-protein kinase At1g53430. No verified direct reference in this release
At3g14840 Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840. No verified direct reference in this release
At1g53440 Probable LRR receptor-like serine/threonine-protein kinase At1g53440. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027435 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process
GO:0031667 response to nutrient levels Biological Process
GO:0045088 regulation of innate immune response Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT1G07650
ath:AT1G29750
ath:AT1G53420
ath:AT1G53430
ath:AT3G14840
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.785
Rank 1 · TkA07G058850 · TK1151
Cytoplasm0.122
Rank 2 · TkA07G058850 · TK1151
Endoplasmic reticulum0.085
Rank 3 · TkA07G058850 · TK1151
Nucleus0.073
Rank 4 · TkA07G058850 · TK1151
Lysosome / Vacuole0.046
Rank 5 · TkA07G058850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11721Malectin13-138 aa
PF04478Mid2152-195 aa
PF02439Adeno_E3_CR2162-191 aa
PF27913EVI2B162-197 aa
PF00069Pkinase216-484 aa
PF07714PK_Tyr_Ser-Thr218-486 aa
PF03109ABC1220-245 aa
PF12330Haspin_kinase311-376 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G058850PF11721Malectin131381.6e-33116.7
TkA07G058850PF04478Mid21521950.005417.2
TkA07G058850PF02439Adeno_E3_CR21621910.06613.7
TkA07G058850PF27913EVI2B1621970.2911.5
TkA07G058850PF00069Pkinase2164842.5e-45155.7
TkA07G058850PF07714PK_Tyr_Ser-Thr2184865.2e-49167.6
TkA07G058850PF03109ABC12202450.03913.8
TkA07G058850PF12330Haspin_kinase3113760.01215.4
TkA07G058850PF03109ABC13273650.03913.8
TkA07G058850PF17667Pkinase_fungal3343870.02713.9
TkA07G058850PF11721Malectin5305431.6e-33116.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FXF2Arabidopsis thalianasp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK155.200%Swiss-ProtHigh
C0LGE0Arabidopsis thalianasp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g0765057.700%Swiss-ProtHigh
C0LGG8Arabidopsis thalianasp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5343059.300%Swiss-ProtHigh
C0LGN2Arabidopsis thalianasp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g1484060.500%Swiss-ProtHigh
C0LGG9Arabidopsis thalianasp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5344058.000%Swiss-ProtHigh

JBrowse

View in Genome Browser