TkA07G058410 | RubberDandelionOmics

Gene overview

TkA07G058410

Reference: TK1151 Chr: Chr07 Coordinates: 15456810-15457750 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

567 bp · TkA07G058410|TK1151|cDNA

ATGGCGGAGTTACTTGCAACATACTTCTTGGTGTTTGTCGGATGTGGCGTGATCACGATGAACGTTGACAAAAACAATCCAGTGGGTATGCCTGGAATAGCCATCGTATGGGGGGCGGCGGTGATGGTGATGGTTTACTCTGTCGGTCACATCTCCGGTGCACATATCAACCCTGCAGTCACCATCGCTTTTGCTACTTGCAAAAGGTTTCCATGGAAAGAGGTTCCCGGATACGTGATTGCTCAAATCCTTGCATCAAC...

CDS

Download CDS FASTA

567 bp · TkA07G058410|TK1151|CDS

ATGGCGGAGTTACTTGCAACATACTTCTTGGTGTTTGTCGGATGTGGCGTGATCACGATGAACGTTGACAAAAACAATCCAGTGGGTATGCCTGGAATAGCCATCGTATGGGGGGCGGCGGTGATGGTGATGGTTTACTCTGTCGGTCACATCTCCGGTGCACATATCAACCCTGCAGTCACCATCGCTTTTGCTACTTGCAAAAGGTTTCCATGGAAAGAGGTTCCCGGATACGTGATTGCTCAAATCCTTGCATCAAC...

Protein

Download Protein FASTA

188 aa · TkA07G058410|TK1151|PROTEIN

MAELLATYFLVFVGCGVITMNVDKNNPVGMPGIAIVWGAAVMVMVYSVGHISGAHINPAVTIAFATCKRFPWKEVPGYVIAQILASTLASGTLRLIFSVIIYPQTGQLAGVAIGATVLLNAMFAGQVSGASMNPARSIGPAIVWNQYRGLWVYILGPMVGAIGGAWAYKTLRFTDKPLCEITKRASQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G058410`
TK1151 ID	TkA07G058410
OH-1004 ID	LXL04_027425
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.700
Protein coverage (%)	TK1151 100.000 / OH-1004 82.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G058410

Location Chr07:15456810-15457750 (+)

Description Similar to NIP1-1: Aquaporin NIP1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18910`	Water channel probably required to promote glycerol permeability and water transport across cell membranes.	Functional identification of the glycerol permease activity of Arabidopsis thaliana NLM1 and NLM2 proteins by heterologous expression in Saccharomyces cerevisiae.2000 · DOI: 10.1016/s0014-5793(00)02027-5
`At4g19030`	Water channel probably required to promote glycerol permeability and water transport across cell membranes.	Functional identification of the glycerol permease activity of Arabidopsis thaliana NLM1 and NLM2 proteins by heterologous expression in Saccharomyces cerevisiae.2000 · DOI: 10.1016/s0014-5793(00)02027-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0232900`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`Os05g0205000`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027425 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015700 arsenite transport Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0080170 hydrogen peroxide transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015105 arsenite transmembrane transporter activity Molecular Function

GO:0015250 water channel activity Molecular Function

GO:0015267 channel activity Molecular Function

KEGG gene cross-reference

ath:AT4G18910

ath:AT4G19030

dosa:Os02g0232900

dosa:Os05g0205000

osa:4338071

zma:542741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.629

Rank 1 · TkA07G058410 · TK1151

Cytoplasm0.153

Rank 2 · TkA07G058410 · TK1151

Mitochondrion0.142

Rank 3 · TkA07G058410 · TK1151

Endoplasmic reticulum0.125

Rank 4 · TkA07G058410 · TK1151

Lysosome / Vacuole0.066

Rank 5 · TkA07G058410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP1-98 aa

PF11151DUF29299-21 aa

PF11151DUF292933-55 aa

PF11151DUF292977-100 aa

PF00230MIP105-168 aa

PF11151DUF2929150-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G058410	`PF00230`	MIP	1	98	4.3e-46	158.2
TkA07G058410	`PF11151`	DUF2929	9	21	5.6	8.0
TkA07G058410	`PF11151`	DUF2929	33	55	5.6	8.0
TkA07G058410	`PF11151`	DUF2929	77	100	5.6	8.0
TkA07G058410	`PF00230`	MIP	105	168	4.3e-46	158.2
TkA07G058410	`PF11151`	DUF2929	150	173	5.6	8.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFP7`	Arabidopsis thaliana	sp\|Q8LFP7\|NIP12_ARATH Aquaporin NIP1-2	52.000%	Swiss-Prot	High
`Q8VZW1`	Arabidopsis thaliana	sp\|Q8VZW1\|NIP11_ARATH Aquaporin NIP1-1	50.400%	Swiss-Prot	High
`Q40746`	Oryza sativa subsp. japonica	sp\|Q40746\|NIP11_ORYSJ Aquaporin NIP1-1	54.300%	Swiss-Prot	High
`Q0DK16`	Oryza sativa subsp. japonica	sp\|Q0DK16\|NIP13_ORYSJ Aquaporin NIP1-3	51.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card