TkA07G056080 | RubberDandelionOmics

Gene overview

TkA07G056080

Reference: TK1151 Chr: Chr07 Coordinates: 14917087-14917703 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA07G056080|TK1151|cDNA

ATGCAACTCTTTGGAAGTTCTGAGATCAGTCCATCTCTGCTGGTACTGACGGCATCATGCAACAATACACACATGATGTATGTGTTGAATAGAAACGACGTTTGTTTGATTTACAGGGAGTGGAATCGCCCTCTTCGTGCCCTCTATTCCAAGCAGGATCATAAGCTCATGTTTGGTGTCCTTTTCTCTCTCAAATCCCTAACCGCAAAGATGGATCCATCTAGTACATCCGGCAGGATGAAGGTGTTGAAAAAGTTGTG...

CDS

Download CDS FASTA

336 bp · TkA07G056080|TK1151|CDS

ATGCAACTCTTTGGAAGTTCTGAGATCAGTCCATCTCTGCTGGTACTGACGGCATCATGCAACAATACACACATGATGTATGTGTTGAATAGAAACGACGTTTGTTTGATTTACAGGGAGTGGAATCGCCCTCTTCGTGCCCTCTATTCCAAGCAGGATCATAAGCTCATGTTTGGTGTCCTTTTCTCTCTCAAATCCCTAACCGCAAAGATGGATCCATCTAGTACATCCGGCAGGATGAAGGTGTTGAAAAAGTTGTG...

Protein

Download Protein FASTA

111 aa · TkA07G056080|TK1151|PROTEIN

MQLFGSSEISPSLLVLTASCNNTHMMYVLNRNDVCLIYREWNRPLRALYSKQDHKLMFGVLFSLKSLTAKMDPSSTSGRMKVLKKLWSLWMRIQSTRKILSYRFHSCLCYC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G056080`
TK1151 ID	TkA07G056080
OH-1004 ID	LXL04_027406
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 66.667 / OH-1004 32.889 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G056080`
Location	Chr07:14917087-14917703 (-)
Description	Similar to RFC1: Replication factor C subunit 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027406` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000712 resolution of meiotic recombination intermediates Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006901 vesicle coating Biological Process GO:0006974 DNA damage response Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0048208 COPII vesicle coating Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0099022 vesicle tethering Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT5G22010 dosa:Os11g0572100 hsa:58485 mmu:245828 rno:287427 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.340

Rank 1 · TkA07G056080 · TK1151

Cytoplasm0.335

Rank 2 · TkA07G056080 · TK1151

Endoplasmic reticulum0.203

Rank 3 · TkA07G056080 · TK1151

Mitochondrion0.122

Rank 4 · TkA07G056080 · TK1151

Golgi apparatus0.090

Rank 5 · TkA07G056080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04099Sybindin24-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G056080	`PF04099`	Sybindin	24	79	2.1e-13	51.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card