TkA07G056040 | RubberDandelionOmics

Gene overview

TkA07G056040

Reference: TK1151 Chr: Chr07 Coordinates: 14908697-14910153 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1320 bp · TkA07G056040|TK1151|cDNA

CAGAGGTGCAGATTGCATGCTTCTAGAGGTACAGACAGAGGTACAATTTACAGAGCAACGATTTTTGTGCGGGTTTTTCTGGGGAAAACAGCGAGAGCTCCGTTGCAGATATGGAAATGGTGGAAAAAGTTCAAAATCAACCTACAATCTCCCCAAACCGGATAAATTCGCCAGAAATCTTCGAAAAGGGGGAAGAAGACCGAATCAGTACATTGCCAGATTGCATGCTTCTAGAAATCCTCTCTCGTTTACCCTCCACA...

CDS

Download CDS FASTA

1086 bp · TkA07G056040|TK1151|CDS

ATGGAAATGGTGGAAAAAGTTCAAAATCAACCTACAATCTCCCCAAACCGGATAAATTCGCCAGAAATCTTCGAAAAGGGGGAAGAAGACCGAATCAGTACATTGCCAGATTGCATGCTTCTAGAAATCCTCTCTCGTTTACCCTCCACAAAAGCCGCCATTCAAACAGGTACACTCTCCAAGCGATGGAAACATCTTTGGACTTCACTTCGTAACCTAATTTTCATTCATATTCCTTCAAAACACAACTGGTCGGAATT...

Protein

Download Protein FASTA

361 aa · TkA07G056040|TK1151|PROTEIN

MEMVEKVQNQPTISPNRINSPEIFEKGEEDRISTLPDCMLLEILSRLPSTKAAIQTGTLSKRWKHLWTSLRNLIFIHIPSKHNWSEFVPFIDETLKQSRQLKLKKFSLYTHDYEPGFNSQIDKWIRYAIRCNVEELSIELWSMYSEEAYQLHLDQRFLTNSYFTHLKLSFCTFNPTVSITWKNLKSLCICYAKLDEDLIENILSGSPVLETLVLDKCYGFSLLNITSKSVKKLVLSGYEDPDVHDPEYIIKINAPNILSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G056040`
TK1151 ID	TkA07G056040
OH-1004 ID	LXL04_027402
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.500
Protein coverage (%)	TK1151 96.676 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G056040

Location Chr07:14908697-14910153 (-)

Description Similar to At3g28410: Putative F-box/LRR-repeat protein At3g28410

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At4g13965`	Putative F-box/FBD/LRR-repeat protein At4g13965.	No verified direct reference in this release
`At5g22700`	F-box/FBD/LRR-repeat protein At5g22700.	No verified direct reference in this release
`At5g54820`	Putative F-box/LRR-repeat protein At5g54820.	No verified direct reference in this release
`At5g50270`	Putative FBD-associated F-box protein At5g50270.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027402 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT3G18150

ath:AT3G28410

ath:AT5G02700

ath:AT5G02930

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.854

Rank 1 · TkA07G056040 · TK1151

Cytoplasm0.208

Rank 2 · TkA07G056040 · TK1151

Endoplasmic reticulum0.035

Rank 3 · TkA07G056040 · TK1151

Cell membrane0.034

Rank 4 · TkA07G056040 · TK1151

Plastid0.015

Rank 5 · TkA07G056040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box32-73 aa

PF12937F-box-like32-66 aa

PF07723LRR_237-48 aa

PF27480ComC_C80-123 aa

PF23622LRR_At1g61320_AtMIF196-264 aa

PF24758LRR_At5g56370121-260 aa

PF27480ComC_C139-163 aa

PF07723LRR_2183-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G056040	`PF00646`	F-box	32	73	6.2e-06	26.6
TkA07G056040	`PF12937`	F-box-like	32	66	0.012	16.1
TkA07G056040	`PF07723`	LRR_2	37	48	0.24	12.8
TkA07G056040	`PF27480`	ComC_C	80	123	0.1	13.4
TkA07G056040	`PF23622`	LRR_At1g61320_AtMIF1	96	264	6.6e-18	66.0
TkA07G056040	`PF24758`	LRR_At5g56370	121	260	4.2e-14	53.5
TkA07G056040	`PF27480`	ComC_C	139	163	0.1	13.4
TkA07G056040	`PF07723`	LRR_2	183	207	0.24	12.8
TkA07G056040	`PF00646`	F-box	194	204	6.2e-06	26.6
TkA07G056040	`PF07723`	LRR_2	209	217	0.24	12.8
TkA07G056040	`PF07723`	LRR_2	229	236	0.24	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	30.300%	Swiss-Prot	Medium
`Q3EA38`	Arabidopsis thaliana	sp\|Q3EA38\|FDL48_ARATH Putative F-box/FBD/LRR-repeat protein At4g13965	31.500%	Swiss-Prot	Medium
`Q9FNJ1`	Arabidopsis thaliana	sp\|Q9FNJ1\|FDL47_ARATH F-box/FBD/LRR-repeat protein At5g22700	30.100%	Swiss-Prot	Medium
`Q9FFU7`	Arabidopsis thaliana	sp\|Q9FFU7\|FBL90_ARATH Putative F-box/LRR-repeat protein At5g54820	24.300%	Swiss-Prot	Low
`Q9FGR8`	Arabidopsis thaliana	sp\|Q9FGR8\|FBD19_ARATH Putative FBD-associated F-box protein At5g50270	28.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card