TkA07G053160 | RubberDandelionOmics

Gene overview

TkA07G053160

Reference: TK1151 Chr: Chr07 Coordinates: 14167685-14169605 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1775 bp · TkA07G053160|TK1151|cDNA

GCAAAACCTCATTTAACCGTAGTTTCCATTCCACTTTGCATTTGGATACATTTCCGCCTAATTTGAGTTCTGTGTAGGGTTCCATAGTCGAAAGTTTCAAAAAATCATGGAGAAGAGGGAAGAAGATCGAATTAGTGCGTTACCAGATTGCTTGCTTCTTGAAATCCTCTCTCGTTTGCCAACCACAAAAAGTGCCATCAAAACAGGTATACTCTCCAAACGGTGGAAACGAATTTGGACTTTGCTTCCTGTTCTGATTT...

CDS

Download CDS FASTA

1008 bp · TkA07G053160|TK1151|CDS

ATGGAGAAGAGGGAAGAAGATCGAATTAGTGCGTTACCAGATTGCTTGCTTCTTGAAATCCTCTCTCGTTTGCCAACCACAAAAAGTGCCATCAAAACAGGTATACTCTCCAAACGGTGGAAACGAATTTGGACTTTGCTTCCTGTTCTGATTTTCAAATGTACTGTTGATAATCGCACGCCGTCGGATTTTGTTTCGTTCGTGGACAAAACCCTAACTCAATGTCGCCAATTGAAGCTCGGCAAACTCGTCTTATCTAC...

Protein

Download Protein FASTA

335 aa · TkA07G053160|TK1151|PROTEIN

MEKREEDRISALPDCLLLEILSRLPTTKSAIKTGILSKRWKRIWTLLPVLIFKCTVDNRTPSDFVSFVDKTLTQCRQLKLGKLVLSTYRDIQFQPQLSNWIRYAISCNVEELRLSLKSADSRVKFEFDQNFFISSCFTDMALVGCVLNPTGAICWKNLKTFYIDHTNLDEDMIENILSGSPVLETLVLDSCYGFKLIDITSKSVKNLVFTGYPKCQVTHDEVGEIIKINAPNILSLSIQEDLVLWKLLLLDVSSLIKVYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G053160`
TK1151 ID	TkA07G053160
OH-1004 ID	LXL04_027368
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G053160

Location Chr07:14167685-14169605 (+)

Description Similar to At3g18150: Putative F-box/LRR-repeat protein At3g18150

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03100`	F-box protein At5g03100.	No verified direct reference in this release
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At3g28410`	Putative F-box/LRR-repeat protein At3g28410.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027368 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT3G18150

ath:AT3G28410

ath:AT5G02700

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.853

Rank 1 · TkA07G053160 · TK1151

Cytoplasm0.205

Rank 2 · TkA07G053160 · TK1151

Endoplasmic reticulum0.033

Rank 3 · TkA07G053160 · TK1151

Cell membrane0.031

Rank 4 · TkA07G053160 · TK1151

Plastid0.016

Rank 5 · TkA07G053160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box9-49 aa

PF12937F-box-like9-43 aa

PF23622LRR_At1g61320_AtMIF179-251 aa

PF24758LRR_At5g5637097-242 aa

PF07723LRR_2130-136 aa

PF07723LRR_2158-181 aa

PF00646F-box167-178 aa

PF07723LRR_2183-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G053160	`PF00646`	F-box	9	49	5.9e-06	26.7
TkA07G053160	`PF12937`	F-box-like	9	43	0.0048	17.3
TkA07G053160	`PF23622`	LRR_At1g61320_AtMIF1	79	251	1.7e-13	51.5
TkA07G053160	`PF24758`	LRR_At5g56370	97	242	1.9e-11	44.8
TkA07G053160	`PF07723`	LRR_2	130	136	0.068	14.6
TkA07G053160	`PF07723`	LRR_2	158	181	0.068	14.6
TkA07G053160	`PF00646`	F-box	167	178	5.9e-06	26.7
TkA07G053160	`PF07723`	LRR_2	183	191	0.068	14.6
TkA07G053160	`PF24758`	LRR_At5g56370	289	310	1.9e-11	44.8
TkA07G053160	`PF07723`	LRR_2	317	323	0.068	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q501G5`	Arabidopsis thaliana	sp\|Q501G5\|FB250_ARATH F-box protein At5g03100	29.900%	Swiss-Prot	Low
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	30.100%	Swiss-Prot	Medium
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	31.600%	Swiss-Prot	Medium
`Q9LSJ3`	Arabidopsis thaliana	sp\|Q9LSJ3\|FBL48_ARATH Putative F-box/LRR-repeat protein At3g28410	27.600%	Swiss-Prot	Low
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	32.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card