TkA07G052710 | RubberDandelionOmics

Gene overview

TkA07G052710

Reference: TK1151 Chr: Chr07 Coordinates: 14028754-14029569 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · TkA07G052710|TK1151|cDNA

ATGGAAACAGTGGAAGAAGGACAAAATCGGAGAAAGATTCTTAAACTGGCGGATGGAGGGGAAGAAGATCGAATCAGTAATTTGCCAGATTGCTTAATTCTTGAAATCCTCTCTCGTTTACACTCCACACAAGACGCCATTAGAACAGGTGCACTTTCCAAACGATGGATACATCTTTGGACTTCGATAACTACTCTCATTTTTAAACATTCAGAATTAGATGATACCCTAACTCCATGTCGCAAAACCCCCACCTCAAG...

CDS

Download CDS FASTA

816 bp · TkA07G052710|TK1151|CDS

ATGGAAACAGTGGAAGAAGGACAAAATCGGAGAAAGATTCTTAAACTGGCGGATGGAGGGGAAGAAGATCGAATCAGTAATTTGCCAGATTGCTTAATTCTTGAAATCCTCTCTCGTTTACACTCCACACAAGACGCCATTAGAACAGGTGCACTTTCCAAACGATGGATACATCTTTGGACTTCGATAACTACTCTCATTTTTAAACATTCAGAATTAGATGATACCCTAACTCCATGTCGCAAAACCCCCACCTCAAG...

Protein

Download Protein FASTA

271 aa · TkA07G052710|TK1151|PROTEIN

METVEEGQNRRKILKLADGGEEDRISNLPDCLILEILSRLHSTQDAIRTGALSKRWIHLWTSITTLIFKHSELDDTLTPCRKTPTSRSDFVSFVDKTLTQCRPSKLKKFVVSTTYDSRFESQVNQWVHYAINFNVEELSLSFYYSGELEGVFPFDQSFFIISCFTHLTLVICELNPTRPISWKNLRNLSLSRLTLDEDLIENILSGSPQLETLELILCCGFNRLDITSRSLKNLVFSGYSDPMCFLGEDIVEINAPNILS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G052710`
TK1151 ID	TkA07G052710
OH-1004 ID	LXL04_027360
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G052710

Location Chr07:14028754-14029569 (+)

Description Similar to At5g03100: F-box protein At5g03100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At5g54820`	Putative F-box/LRR-repeat protein At5g54820.	No verified direct reference in this release
`At3g52680`	F-box/FBD/LRR-repeat protein At3g52680.	No verified direct reference in this release
`At1g78760`	Putative F-box/FBD/LRR-repeat protein At1g78760.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027360 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G49610

ath:AT3G28410

ath:AT5G02920

ath:AT5G02930

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.855

Rank 1 · TkA07G052710 · TK1151

Cytoplasm0.215

Rank 2 · TkA07G052710 · TK1151

Endoplasmic reticulum0.032

Rank 3 · TkA07G052710 · TK1151

Cell membrane0.030

Rank 4 · TkA07G052710 · TK1151

Plastid0.018

Rank 5 · TkA07G052710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box25-62 aa

PF12937F-box-like25-56 aa

PF24758LRR_At5g5637030-62 aa

PF29594LRR_SKP2105-141 aa

PF23622LRR_At1g61320_AtMIF1109-266 aa

PF13385Laminin_G_3115-154 aa

PF24758LRR_At5g56370124-267 aa

PF29594LRR_SKP2183-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G052710	`PF00646`	F-box	25	62	0.0003	21.3
TkA07G052710	`PF12937`	F-box-like	25	56	0.00056	20.3
TkA07G052710	`PF24758`	LRR_At5g56370	30	62	5.4e-16	59.7
TkA07G052710	`PF29594`	LRR_SKP2	105	141	0.26	11.2
TkA07G052710	`PF23622`	LRR_At1g61320_AtMIF1	109	266	4.7e-15	56.6
TkA07G052710	`PF13385`	Laminin_G_3	115	154	0.19	12.6
TkA07G052710	`PF24758`	LRR_At5g56370	124	267	5.4e-16	59.7
TkA07G052710	`PF29594`	LRR_SKP2	183	223	0.26	11.2
TkA07G052710	`PF00646`	F-box	195	211	0.0003	21.3
TkA07G052710	`PF12937`	F-box-like	225	237	0.00056	20.3
TkA07G052710	`PF00646`	F-box	227	235	0.0003	21.3
TkA07G052710	`PF29594`	LRR_SKP2	228	269	0.26	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	37.000%	Swiss-Prot	Medium
`Q9FFU7`	Arabidopsis thaliana	sp\|Q9FFU7\|FBL90_ARATH Putative F-box/LRR-repeat protein At5g54820	28.400%	Swiss-Prot	Low
`Q9LXJ6`	Arabidopsis thaliana	sp\|Q9LXJ6\|FDL21_ARATH F-box/FBD/LRR-repeat protein At3g52680	31.500%	Swiss-Prot	Medium
`Q9ZV94`	Arabidopsis thaliana	sp\|Q9ZV94\|FDL11_ARATH Putative F-box/FBD/LRR-repeat protein At1g78760	28.500%	Swiss-Prot	Low
`Q8LF09`	Arabidopsis thaliana	sp\|Q8LF09\|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160	28.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card