TkA07G047960 | RubberDandelionOmics

Gene overview

TkA07G047960

Reference: TK1151 Chr: Chr07 Coordinates: 12749341-12755047 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1199 bp · TkA07G047960|TK1151|cDNA

GTTGGGTCGATGTCACATTTGAAAATAAATTGATAATAGAGTGCCAAATTTGAAACAAAAAATAACACAGTGTCAAAATAGAATTTTGTATAAACTTGAGGTTTTTTATATAATTTACCCTTTTTTTTTACCAGATATGAGCTTGGTGTCTAAAATTGATTTCTAGCAATGTAATTTGAGTTTGATGTTTTCTGACTTTGAACCTTCTACACCATGATTGTTGGCATATATTAACCGATAACCGATCACCTTTTATTAAC...

CDS

Download CDS FASTA

1776 bp · TkA07G047960|TK1151|CDS

ATGTCAGCTTTCTCGGTCAAGTTCCTAGCACCCAATTCATTTCTCAGTCCTATAACCAATATCAAATCCACCAGGCTATATGCAAATCCATCACAAACCGCCGTGCCTGCTCCTCCACTTCAGGCGGCGGAGGAGATCCCGGCGGAAAGACTGGAACCCAGAGTCGAAAAGAAAGGTGGGTATTATGTACTGAAAGAGAAGTTCCGGCAAGGTATTAATCCACAAGAAAAGGTGAAAATTGGTGCTGAACCCATGAAACT...

Protein

Download Protein FASTA

591 aa · TkA07G047960|TK1151|PROTEIN

MSAFSVKFLAPNSFLSPITNIKSTRLYANPSQTAVPAPPLQAAEEIPAERLEPRVEKKGGYYVLKEKFRQGINPQEKVKIGAEPMKLFMENGIEDLAKIPFEEIDKAKDTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSAQTRYLASVIKQYGEDGCADVTTRQNWQIRGVTLPDVPAILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPYEIVDTRPYTNLLSQFITANSKGNPEFTNLPRKWNVCVIGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G047960`
TK1151 ID	TkA07G047960
OH-1004 ID	LXL04_027306
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G047960

Location Chr07:12749341-12755047 (-)

Description Similar to NIR1: Ferredoxin--nitrite reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g15620`	Catalyzes the six-electron reduction of nitrite to ammonium.	No verified direct reference in this release
`At2g18960`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306
`At4g30190`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	Mechanism of proton transport by plant plasma membrane proton ATPases.2003 · DOI: 10.1007/s10265-003-0111-9 The effect of a genetically reduced plasma membrane protonmotive force on vegetative growth of Arabidopsis.2012 · DOI: 10.1104/pp.111.189167 Abscisic acid suppresses hypocotyl elongation by dephosphorylating plasma membrane H(+)-ATPase in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pcu028 The plasma membrane H(+) -ATPase AHA2 contributes to the root architecture in response to different nitrogen supply.2015 · DOI: 10.1111/ppl.12305 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 Direct observation of proton pumping by a eukaryotic P-type ATPase.2016 · DOI: 10.1126/science.aad6429

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0357100`	Catalyzes the six-electron reduction of nitrite to ammonium.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027306 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010167 response to nitrate Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0048307 ferredoxin-nitrite reductase activity Molecular Function

GO:0050421 nitrite reductase (NO-forming) activity Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT2G15620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.927

Rank 1 · TkA07G047960 · TK1151

Mitochondrion0.103

Rank 2 · TkA07G047960 · TK1151

Cytoplasm0.055

Rank 3 · TkA07G047960 · TK1151

Peroxisome0.029

Rank 4 · TkA07G047960 · TK1151

Nucleus0.020

Rank 5 · TkA07G047960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03460NIR_SIR_ferr127-194 aa

PF01077NIR_SIR203-361 aa

PF03460NIR_SIR_ferr386-449 aa

PF01077NIR_SIR466-580 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G047960	`PF03460`	NIR_SIR_ferr	127	194	5.7e-41	138.8
TkA07G047960	`PF01077`	NIR_SIR	203	361	3.4e-55	186.5
TkA07G047960	`PF03460`	NIR_SIR_ferr	386	449	5.7e-41	138.8
TkA07G047960	`PF01077`	NIR_SIR	466	580	3.4e-55	186.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39161`	Arabidopsis thaliana	sp\|Q39161\|NIR_ARATH Ferredoxin--nitrite reductase, chloroplastic	78.500%	Swiss-Prot	High
`P20649`	Arabidopsis thaliana	sp\|P20649\|PMA1_ARATH ATPase 1, plasma membrane-type	91.000%	Swiss-Prot	High
`P19456`	Arabidopsis thaliana	sp\|P19456\|PMA2_ARATH ATPase 2, plasma membrane-type	91.700%	Swiss-Prot	High
`Q42997`	Oryza sativa subsp. japonica	sp\|Q42997\|NIR_ORYSJ Ferredoxin--nitrite reductase, chloroplastic	76.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card