TkA07G045930 | RubberDandelionOmics

Gene overview

TkA07G045930

Reference: TK1151 Chr: Chr07 Coordinates: 12258006-12267585 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5612 bp · TkA07G045930|TK1151|cDNA

ATAAGCCGTACCCAAAACCCAGGAACCAGTAAAGTAAAAGAAAGTATATAAATTGATTTTGATTTTACCAAAACCTAAATATAGCAATGTTTCCATAAATTAAAAACAAAAAAAAGTCAAAATTCCCTAAATTCAACTGCTTTTTTCGTCTCTCAGATCAAAACACAAGTGAAATAAGCTTGATAATATCATCATCATCGAATCCAAGAAAGAAACACACAACGTGTTTGAGTTAAATACAATTCAATTTCTAAATTGTA...

CDS

Download CDS FASTA

1020 bp · TkA07G045930|TK1151|CDS

ATGCTACAAAAAATCGAGACATCATTCAAAGAAAACATCAAAAGAAACCTCAACATCTCCAAAACCACAGACGTAAATCACACGGACCATCTCTCGGATTCAACCGAACCGTCCCCGTCTTTCACCATCGAACTCGGGAGAAACGAAACCGAAAAAAACAACGCGATGAATCGGTATCAAGATCTCGAGAAATGGATGTGGAAAGAGTGTCTCTATTCATCGAATTTGTCGGCTATGAAACACGGGAAACAAAGGTGTGC...

Protein

Download Protein FASTA

339 aa · TkA07G045930|TK1151|PROTEIN

MLQKIETSFKENIKRNLNISKTTDVNHTDHLSDSTEPSPSFTIELGRNETEKNNAMNRYQDLEKWMWKECLYSSNLSAMKHGKQRCAPLHGVCDSCRACYCFEDVNCPICPRCGRGFSTFGGKLSYPEEIRGNVGGFDDWDVSDPLRIRLIKSLLTFLEASVPFEALQSCWMESNRNAWGSKLHSSLSPADLLQILTWFESVIKRDHLSLDFETTEELLGTSGVPEKAVTGSVPILPWVPQTTAAVALRLLELDASISYT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G045930`
TK1151 ID	TkA07G045930
OH-1004 ID	LXL04_027287
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 90.560 / OH-1004 18.648 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G045930

Location Chr07:12258006-12267585 (+)

Description Similar to RLT2: Homeobox-DDT domain protein RLT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28420`	Transcriptional regulator required for the maintenance of the plant vegetative phase.	Imitation Switch chromatin remodeling factors and their interacting RINGLET proteins act together in controlling the plant vegetative phase in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05074.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027287 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0005634 nucleus Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0031010 ISWI-type complex Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G28420

ath:AT5G44180

ddi:DDB_G0284293

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.416

Rank 1 · TkA07G045930 · TK1151

Cytoplasm0.372

Rank 2 · TkA07G045930 · TK1151

Cell membrane0.138

Rank 3 · TkA07G045930 · TK1151

Mitochondrion0.126

Rank 4 · TkA07G045930 · TK1151

Endoplasmic reticulum0.087

Rank 5 · TkA07G045930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31066DUF8799145-208 aa

PF24716WapI181-262 aa

PF31066DUF8799307-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G045930	`PF31066`	DUF8799	145	208	4.9e-22	78.3
TkA07G045930	`PF24716`	WapI	181	262	0.059	14.3
TkA07G045930	`PF31066`	DUF8799	307	318	4.9e-22	78.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HY56`	Arabidopsis thaliana	sp\|F4HY56\|RLT1_ARATH Homeobox-DDT domain protein RLT1	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card